FC931174

Overview
NameFC931174
Unique NameFC931174
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length708
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC931174_ssr632 microsatellite FC931174_ssr632:632..643. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of FC931174 vs. ExPASy Swiss-Prot
Match: P2B15_ARATH (F-box protein PP2-B15 OS=Arabidopsis thaliana GN=PP2B15 PE=2 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 2.449e-42
Identity = 55/120 (45.83%), Postives = 76/120 (63.33%), Query Frame = 1
Query:  295 KTFSLEKSTSKKRYILGARELSITWANNPLYWTWKPFLQSRFTEVAELRTISWLQITGKINTKTISPKTQYAAYLIVKFAERAFGLDSLPSEVSLEVGNGSXQSQGTAYLRWQERKIQLE 654
            K F +EK + K  YIL +R+LSITW++   YW+W P   SRF+E  +L    WL+I GKI T  +SP T Y AYLI+K   RA+GLD +P+E S++VGNG  + + T       +K Q+E
Sbjct:   82 KIFKIEKLSGKISYILSSRDLSITWSDQRHYWSWSPRSDSRFSEGVQLIMTDWLEIIGKIQTGALSPNTNYGAYLIMKVTSRAYGLDLVPAETSIKVGNGEKKIKSTYLSCLDNKKQQME 201          

HSP 2 Score: 78.5666 bits (192), Expect = 2.449e-42
Identity = 40/78 (51.28%), Postives = 50/78 (64.10%), Query Frame = 3
Query:   63 LLPEDCFAHILSYTSPRDACRLSLVSSTVRFAADSDNVWEKFLPVDYMEILPRLVLP-LVYFSKKELFTRLCSPVLID 293
            +LPE C A ILS+T+P D    + VSS  R A DSD VWEKFLP DY  ++ R   P  ++ SKKEL+  LC  +LID
Sbjct:    1 MLPEACVATILSFTTPADTISSAAVSSVFRVAGDSDFVWEKFLPTDYCHVISRSTDPHRIFSSKKELYRCLCESILID 78          
BLAST of FC931174 vs. ExPASy Swiss-Prot
Match: P2B10_ARATH (F-box protein PP2-B10 OS=Arabidopsis thaliana GN=PP2B10 PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.776e-36
Identity = 39/97 (40.21%), Postives = 65/97 (67.01%), Query Frame = 1
Query:  295 KTFSLEKSTSKKRYILGARELSITWANNPLYWTWKPFLQSRFTEVAELRTISWLQITGKINTKTISPKTQYAAYLIVKFAERAFGLDSLPSEVSLEV 585
            K+  LEK++ K+  +L A  LSI W +NP YW W P  +SRF +VA+LR + W +I G+ NT+ +SP+T+Y+AY++ K  ++ +G  ++  E ++ V
Sbjct:   94 KSVWLEKASGKRCLMLSAMNLSIIWGDNPQYWQWIPIPESRFEKVAKLRDVCWFEIRGRTNTRVLSPRTRYSAYIVFKGVDKCYGFQNVAIEAAVGV 190          

HSP 2 Score: 80.4925 bits (197), Expect = 1.776e-36
Identity = 40/81 (49.38%), Postives = 52/81 (64.20%), Query Frame = 3
Query:   60 DLLPEDCFAHILSYTSPRDACRLSLVSSTVRFAADSDNVWEKFLPVDYMEILPRLVLPLVYFSKKELFTRLCS-PVLIDQD 299
            D  PEDC ++I+S+T+PRDAC  + VS T      SD +WEKFLP DY  ++P      V+ SKKEL+  LC+ PVL D D
Sbjct:   15 DSFPEDCISYIISFTNPRDACVAATVSKTFESTVKSDIIWEKFLPADYESLIPP---SRVFSSKKELYFSLCNDPVLFDDD 92          
BLAST of FC931174 vs. ExPASy Swiss-Prot
Match: P2B14_ARATH (F-box protein PP2-B14 OS=Arabidopsis thaliana GN=PP2B14 PE=2 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 3.922e-36
Identity = 53/138 (38.41%), Postives = 81/138 (58.70%), Query Frame = 1
Query:  295 KTFSLEKSTSKKRYILGARELSITWANNPLYWTWKPFLQSRFTEVAELRTISWLQITGKINTKTISPKTQYAAYLIVKFAERAFGLDSLPSEVSLEVGNGSXQSQGTAYLRWQERKIQLECLGHLYFLHRDEALRSRV 708
            K F + K + K  Y+L AR++SIT +++  YW+W     SRF+E AEL     L+I GKI T+ +S  T+Y AYLIVK  + A+GLD +P+E S++  NG      T      E+K Q++    L++ +R+E +   V
Sbjct:   84 KLFKINKFSGKISYVLSARDISITHSDHASYWSWSNVSDSRFSESAELIITDRLEIEGKIQTRVLSANTRYGAYLIVKVTKGAYGLDLVPAETSIKSKNGQISKSATYLCCLDEKKQQMK---RLFYGNREERMAMTV 218          

HSP 2 Score: 72.7886 bits (177), Expect = 3.922e-36
Identity = 42/88 (47.73%), Postives = 54/88 (61.36%), Query Frame = 3
Query:   63 LLPEDCFAHILSYTSPRDACRLSLVSSTVRFAADSDNVWEKFLPVDYMEILPRLV-LPLVYFSKKELFTRLCSPVLIDQDFFLREINE 323
            +LPE C A+IL++TSP DA   S VSS  R A DSD VWEKFLP DY  ++ +         SKKE++  LC  +LID    L +IN+
Sbjct:    3 MLPEACIANILAFTSPADAFSSSEVSSVFRLAGDSDFVWEKFLPSDYKSLISQSTDHHWNISSKKEIYRCLCDSLLIDNARKLFKINK 90          
BLAST of FC931174 vs. ExPASy Swiss-Prot
Match: P2B13_ARATH (F-box protein PP2-B13 OS=Arabidopsis thaliana GN=PP2B13 PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 6.656e-36
Identity = 54/138 (39.13%), Postives = 81/138 (58.70%), Query Frame = 1
Query:  295 KTFSLEKSTSKKRYILGARELSITWANNPLYWTWKPFLQSRFTEVAELRTISWLQITGKINTKTISPKTQYAAYLIVKFAERAFGLDSLPSEVSLEVGNGSXQSQGTAYLRWQERKIQLECLGHLYFLHRDEALRSRV 708
            K F + K + K  YIL AR++SIT++++  Y +W     SRF+E AEL T   L+I GKI T  +SP T+Y AYLI+K    A+GLD +P+E S++  NG      T      E+K Q++    L++ +R+E +   V
Sbjct:   84 KLFKINKFSGKISYILSARDISITYSDHASYCSWSNVSDSRFSESAELITTDRLEIKGKIQTTVLSPNTKYGAYLIMKVTNGAYGLDLVPAETSVKSKNGQNNKNTTYLCCLDEKKQQMK---RLFYGNREERMAMTV 218          

HSP 2 Score: 73.559 bits (179), Expect = 6.656e-36
Identity = 41/88 (46.59%), Postives = 55/88 (62.50%), Query Frame = 3
Query:   63 LLPEDCFAHILSYTSPRDACRLSLVSSTVRFAADSDNVWEKFLPVDYMEILPRLV-LPLVYFSKKELFTRLCSPVLIDQDFFLREINE 323
            +LPE C A+IL++TSP DA   S VSS  R A DSD VWEKFLP  Y  ++ +      ++ SKKE++  LC  +LID    L +IN+
Sbjct:    3 MLPEACVANILAFTSPADAFSSSEVSSVFRLAGDSDFVWEKFLPSHYKSLISQSTDHHRIFSSKKEIYRCLCDSLLIDNARKLFKINK 90          
BLAST of FC931174 vs. ExPASy Swiss-Prot
Match: FB95_ARATH (F-box protein At2g02240 OS=Arabidopsis thaliana GN=At2g02240 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.468e-35
Identity = 41/95 (43.16%), Postives = 63/95 (66.32%), Query Frame = 1
Query:  295 KTFSLEKSTSKKRYILGARELSITWANNPLYWTWKPFLQSRFTEVAELRTISWLQITGKINTKTISPKTQYAAYLIVKFAERAFGLDSLPSEVSL 579
            K+F LEK++ K+  +L ++EL ITW ++P YW W    +SRF ++AEL  + W +I GK + + +SP T+Y+AY++ K  +R  GL  LP EV L
Sbjct:  141 KSFWLEKASGKRCIMLSSKELWITWGSSPEYWQWISIPESRFNKIAELLDVCWFEIRGKTSARVLSPGTRYSAYIVFKTKDRCPGLGHLPVEVGL 235          

HSP 2 Score: 79.337 bits (194), Expect = 1.468e-35
Identity = 41/79 (51.90%), Postives = 55/79 (69.62%), Query Frame = 3
Query:   60 DLLPEDCFAHILSYTSPRDACRLSLVSSTVRFAADSDNVWEKFLPVDYMEILPRLVLPLVYFSKKELFTRLC-SPVLID 293
            D+LPEDC ++I+S+TSPRDAC  + VS T   A  SD VW+KFLP +Y  ++ R     V+ SKKEL+  LC +PVLI+
Sbjct:   62 DVLPEDCISNIISFTSPRDACVAASVSKTFESAVSSDCVWDKFLPPEYESLVSR---SRVFASKKELYFALCHNPVLIE 137          
BLAST of FC931174 vs. ExPASy Swiss-Prot
Match: P2B12_ARATH (Putative F-box protein PP2-B12 OS=Arabidopsis thaliana GN=PP2B12 PE=4 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 4.580e-34
Identity = 53/144 (36.81%), Postives = 78/144 (54.17%), Query Frame = 1
Query:  298 TFSLEKSTSKKRYILGARELSITWANNPLYWTWKPFLQSRFTEVAELRTISWLQITGKINTKTISPKTQYAAYLIVKFAER-AFGLDSLPSEVSLEVGNGSXQSQGTAYLR--WQERK----IQLECLGHLYFLHRDEALRSRV 708
            +F +EK + KK ++L AR+L I W ++P +W W     SRF EVA L  + W +I GKI+T  +S  T Y+AYL+ K  E  +FG +SLP EVS         +    +L+   QE +    +++E LG  Y    DE +   V
Sbjct:   84 SFWMEKRSGKKCWMLSARKLDIVWVDSPEFWIWVSIPDSRFEEVAGLLMVCWFEIRGKISTSLLSKATNYSAYLVFKEQEMGSFGFESLPLEVSFRSTRTEVYNNRRVFLKSGTQESREDGWLEIE-LGEYYVGFDDEEIEMSV 226          

HSP 2 Score: 78.1814 bits (191), Expect = 4.580e-34
Identity = 42/82 (51.22%), Postives = 54/82 (65.85%), Query Frame = 3
Query:   51 MNVDLLPEDCFAHILSYTSPRDACRLSLVSSTVRFAADSDNVWEKFLPVDYMEILPRLVLPLVYFSKKELFTRLC-SPVLID 293
            MN   LPE+C A ++S+TSP DACR+S VS  +R AADS+  WE+FLP DY   +      L  FS K+LF R C SP+LI+
Sbjct:    1 MNFLDLPEECIATMISFTSPFDACRISAVSKLLRSAADSNTTWERFLPSDYRMYIDN---SLSRFSNKQLFLRFCESPLLIE 79          
BLAST of FC931174 vs. ExPASy Swiss-Prot
Match: PP2B2_ARATH (Putative F-box protein PP2-B2 OS=Arabidopsis thaliana GN=PP2B2 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.844e-32
Identity = 43/91 (47.25%), Postives = 62/91 (68.13%), Query Frame = 3
Query:   60 DLLPEDCFAHILSYTSPRDACRLSLVSSTVRFAADSDNVWEKFLPVDYMEILPRLVLPLVYFSKKELFTRLC-SPVLID---QDFFLREIN 320
            D LPEDC ++I+S+TSPRDAC  + VS T   A +SD+VW+KFLP DY  ++P      V+ SKKEL+  +C +PVL++   + F+L + N
Sbjct:   43 DNLPEDCISNIISFTSPRDACVAASVSKTFESAVNSDSVWDKFLPSDYSSLVPP---SRVFSSKKELYFAICDNPVLVEDGGKSFWLEKEN 130          

HSP 2 Score: 78.9518 bits (193), Expect = 1.844e-32
Identity = 40/105 (38.10%), Postives = 61/105 (58.10%), Query Frame = 1
Query:  295 KTFSLEKSTSKKRYILGARE-LSITWANNPLYWTWKPFLQSRFTEVAELRTISWLQITGKINTKTISPKTQYAAYLIVKFAERAFGLDSLPSEVSLE-VGNGSXQ 603
            K+F LEK   KK ++L  ++ + ITW + P YW W    ++RF EV EL  + W ++ G +NTK +SP T+Y+AY++ K       L  +P E ++  VG  S Q
Sbjct:  122 KSFWLEKENGKKCFMLSPKKSMWITWVSTPQYWRWISIPEARFEEVPELLNVCWFEVRGGMNTKELSPGTRYSAYIVFKTKNGCPNLGDVPVEATVGLVGQESSQ 226          
BLAST of FC931174 vs. ExPASy Swiss-Prot
Match: PP2B1_ARATH (F-box protein PP2-B1 OS=Arabidopsis thaliana GN=PP2B1 PE=1 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 3.363e-31
Identity = 39/96 (40.62%), Postives = 62/96 (64.58%), Query Frame = 1
Query:  295 KTFSLEKSTSKKRYILGARELSITWANNPLYWTWKPFLQSRFTEVAELRTISWLQITGKINTKTISPKTQYAAYLIVKFAE-RAFGLDSLPSEVSL 579
            K+F +EK++ KK Y+L A EL+I W ++P YW W    +S+F +VAELR + W ++ GKI+   +S  T Y+ Y++ K A  R++G D +P E  +
Sbjct:  112 KSFWVEKASGKKCYMLSAMELTIIWGDSPAYWKWITVPESKFEKVAELRNVCWFEVRGKISCGMLSKGTHYSVYVVFKTANGRSYGFDLVPVEAGV 207          

HSP 2 Score: 69.707 bits (169), Expect = 3.363e-31
Identity = 36/79 (45.57%), Postives = 53/79 (67.09%), Query Frame = 3
Query:   60 DLLPEDCFAHILSYTSPRDACRLSLVSSTVRFAADSDNVWEKFLPVDYMEILPRLVLPLVYFSKKELFTRLC-SPVLID 293
            D LPEDC + ++S+TSPRDAC ++ VS +V+ AA SD VWE FLP +Y  +   ++    + SKKE+F  L  + VL++
Sbjct:   33 DALPEDCISKVISHTSPRDACVVASVSKSVKSAAQSDLVWEMFLPSEYSSL---VLQSANHLSKKEIFLSLADNSVLVE 108          
BLAST of FC931174 vs. ExPASy Swiss-Prot
Match: PP2B8_ARATH (Putative F-box protein PP2-B8 OS=Arabidopsis thaliana GN=PP2B8 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.357e-29
Identity = 39/114 (34.21%), Postives = 66/114 (57.89%), Query Frame = 1
Query:  295 KTFSLEKSTSKKRYILGARELSITWANNPLYWTWKPFLQSRFTEVAELRTISWLQITGKINTKTISPKTQYAAYLIVKFAERAFGLDSLPSEVSLEVGNGSXQSQGTAYLRWQE 636
            K+  +EK+ +K+  ++ A  L+I W N+P  W W P  Q+RF  VAEL  +   +I G+IN++ ISPKT+Y+AY++ K     +G +++  EV + V     +     Y+ + E
Sbjct:  118 KSLWIEKANAKRCIMISAMNLAIAWGNSPQSWRWIPDPQARFETVAELLEVCLFEIRGRINSRVISPKTRYSAYIVYKKLNICYGFENVAVEVVVGVVGQDLEESCRRYICFDE 231          

HSP 2 Score: 69.3218 bits (168), Expect = 1.357e-29
Identity = 38/80 (47.50%), Postives = 52/80 (65.00%), Query Frame = 3
Query:   57 VDLLPEDCFAHILSYTSPRDACRLSLVSSTVRFAADSDNVWEKFLPVDYMEILPRLVLPLVYFSKKELFTRLC-SPVLID 293
            +D LPE+C + I+S+TSP+DAC L+ VS T   A  SD VWEKF+P +Y  ++ +      + SKKEL+  LC   VLID
Sbjct:   36 LDDLPEECVSIIVSFTSPQDACVLASVSKTFASAVKSDIVWEKFIPPEYESLISQ-SRAFKFLSKKELYFALCDKSVLID 114          
BLAST of FC931174 vs. ExPASy Swiss-Prot
Match: P2B11_ARATH (F-box protein PP2-B11 OS=Arabidopsis thaliana GN=PP2B11 PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 2.482e-28
Identity = 41/94 (43.62%), Postives = 55/94 (58.51%), Query Frame = 1
Query:  298 TFSLEKSTSKKRYILGARELSITWANNPLYWTWKPFLQSRFTEVAELRTISWLQITGKINTKTISPKTQYAAYLIVKFAERAFGLDSLPSEVSL 579
            +FSLE+ +  K Y++ AR L+I W +   YW W     +RF EVAEL  + WL+ITGKIN   +S  T YAAY + K+    +G    P E SL
Sbjct:   82 SFSLERKSGNKCYMMAARALNIVWGHEQRYWHWISLPNTRFGEVAELIMVWWLEITGKINITLLSDDTLYAAYFVFKWNHSPYGFRQ-PVETSL 174          

HSP 2 Score: 65.4698 bits (158), Expect = 2.482e-28
Identity = 38/77 (49.35%), Postives = 47/77 (61.04%), Query Frame = 3
Query:   66 LPEDCFAHILSYTSPRDACRLSLVSSTVRFAADSDNVWEKFLPVDYMEILPRLVLPLVYFSKKELFTRLC-SPVLID 293
            LPEDC A ILS T+P D CRLS VSS  R AA SD+VW  FLP D+         P    ++K+LF  L  +P+LI+
Sbjct:    4 LPEDCIAKILSLTTPLDVCRLSAVSSIFRSAAGSDDVWNHFLPADFP---AGFAAPAGLPTRKQLFFSLVDNPLLIN 77          
The following BLAST results are available for this feature:
BLAST of FC931174 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 18
Match NameE-valueIdentityDescription
P2B15_ARATH2.449e-4245.83F-box protein PP2-B15 OS=Arabidopsis thaliana GN=P... [more]
P2B10_ARATH1.776e-3640.21F-box protein PP2-B10 OS=Arabidopsis thaliana GN=P... [more]
P2B14_ARATH3.922e-3638.41F-box protein PP2-B14 OS=Arabidopsis thaliana GN=P... [more]
P2B13_ARATH6.656e-3639.13F-box protein PP2-B13 OS=Arabidopsis thaliana GN=P... [more]
FB95_ARATH1.468e-3543.16F-box protein At2g02240 OS=Arabidopsis thaliana GN... [more]
P2B12_ARATH4.580e-3436.81Putative F-box protein PP2-B12 OS=Arabidopsis thal... [more]
PP2B2_ARATH1.844e-3247.25Putative F-box protein PP2-B2 OS=Arabidopsis thali... [more]
PP2B1_ARATH3.363e-3140.63F-box protein PP2-B1 OS=Arabidopsis thaliana GN=PP... [more]
PP2B8_ARATH1.357e-2934.21Putative F-box protein PP2-B8 OS=Arabidopsis thali... [more]
P2B11_ARATH2.482e-2843.62F-box protein PP2-B11 OS=Arabidopsis thaliana GN=P... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34102C06EF PostHarvP1 Citrus clementina cDNA clone C34102C06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931174 ID=FC931174|Name=FC931174|organism=Citrus clementina|type=EST|length=708bp
GACAACACATAAGCTGCAAGACATTAAGTAAAAGAAGAAAAAAGAAAAAA
ATGAACGTAGATCTGCTGCCTGAAGATTGTTTTGCTCACATTTTATCATA
CACATCTCCTAGAGATGCGTGCCGGCTTTCGCTTGTCTCGTCGACGGTAC
GATTTGCGGCCGATTCCGACAATGTGTGGGAGAAATTTTTGCCGGTTGAT
TATATGGAAATTCTCCCAAGATTAGTGTTGCCGCTGGTGTACTTTTCTAA
GAAAGAGCTGTTTACGAGGTTATGTAGCCCAGTTCTAATTGACCAAGACT
TTTTCCTTAGAGAAATCAACGAGCAAGAAACGTTACATTCTAGGTGCAAG
AGAACTTTCAATTACGTGGGCAAACAATCCTCTCTATTGGACCTGGAAAC
CCTTCCTTCAGTCAAGATTTACAGAAGTAGCCGAACTTAGAACCATTAGT
TGGCTACAAATAACTGGTAAAATAAACACCAAAACCATATCACCAAAAAC
ACAATACGCTGCCTACCTCATCGTTAAATTTGCCGAGAGAGCTTTCGGAT
TAGACTCGTTGCCATCAGAAGTATCACTTGAAGTTGGTAATGGCAGCTTN
CAGTCACAAGGGACAGCTTATTTGCGTTGGCAAGAAAGAAAGATACAGTT
AGAATGTCTAGGGCATCTGTACTTTTTGCATCGCGATGAAGCTCTGAGAT
CTAGGGTT
back to top