FC931175

Overview
NameFC931175
Unique NameFC931175
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length717
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15314 contig Ccv1_Contig15314:5..722. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931175 vs. ExPASy Swiss-Prot
Match: CHLY_HEVBR (Hevamine-A OS=Hevea brasiliensis PE=1 SV=2)

HSP 1 Score: 317.775 bits (813), Expect = 3.722e-86
Identity = 156/213 (73.24%), Postives = 172/213 (80.75%), Query Frame = 1
Query:   16 MATNSPAIATFVSLLVTLSLIKASQ--GAGGIVIYWGQNGNEGTLTSTCATSKYAYVNIAFLNKFGNGQTPEINLAGHCNPAAGGCRVVSDAIKSCQSRGIKVMXXXXXXXXXXXXXXXXDAKNVADYLWNNFLGGTSSSRPLGAAVLDGIDFDIEQGSTLHWDDLARFLSAYSSRGKKVYLTAAPQCPFPDRFLGAALNTGLFDYVWVQFYN 648
            MA  + AI   + LL+ +SLI +S     GGI IYWGQNGNEGTLT TC+T KY+YVNIAFLNKFGNGQTP+INLAGHCNPAAGGC +VS+ I+SCQ +GIKVM                DAKNVADYLWNNFLGG SSSRPLG AVLDGIDFDIE GSTL+WDDLAR+LSAYS +GKKVYLTAAPQCPFPDR+LG ALNTGLFDYVWVQFYN
Sbjct:    1 MAKRTQAI---LLLLLAISLIMSSSHVDGGGIAIYWGQNGNEGTLTQTCSTRKYSYVNIAFLNKFGNGQTPQINLAGHCNPAAGGCTIVSNGIRSCQIQGIKVMLSLGGGIGSYTLASQADAKNVADYLWNNFLGGKSSSRPLGDAVLDGIDFDIEHGSTLYWDDLARYLSAYSKQGKKVYLTAAPQCPFPDRYLGTALNTGLFDYVWVQFYN 210          
BLAST of FC931175 vs. ExPASy Swiss-Prot
Match: CHIT3_VITVI (Acidic endochitinase OS=Vitis vinifera GN=CHIT3 PE=2 SV=1)

HSP 1 Score: 292.352 bits (747), Expect = 1.675e-78
Identity = 145/203 (71.43%), Postives = 158/203 (77.83%), Query Frame = 1
Query:   55 LLVTLSLIKASQG--AGGIVIYWGQNGNEGTLTSTCATSKYAYVNIAFLNKFGNGQTPEINLAGHCNPAAGGCRVVSDAIKSCQSRGIKVMXXXXXXXXXXXXXXXXDAKNVADYLWNNFLGGTSSSRPLGAAVLDGIDFDIEQGSTLHWDDLARFLSA---YSSRGKKVYLTAAPQCPFPDRFLGAALNTGLFDYVWVQFYN 648
            LL++LS++   Q   AGGI IYWGQNGNEGTLT TC T KY+YVNIAFLNKFGNGQTPEINLAGHCNPA+ GC  VS  I++CQ+RGIKVM                DA+NVA+YLWNNFLGG SSSRPLG AVLDGIDFDIE GSTLHWDDLAR LS       RG+KVYLTAAPQCPFPD+  G ALNTGLFDYVWVQFYN
Sbjct:   10 LLISLSVLALLQTSYAGGIAIYWGQNGNEGTLTQTCNTGKYSYVNIAFLNKFGNGQTPEINLAGHCNPASNGCTSVSTGIRNCQNRGIKVMLSIGGGAGSYSLSSSNDAQNVANYLWNNFLGGQSSSRPLGDAVLDGIDFDIELGSTLHWDDLARALSRIEFQQERGRKVYLTAAPQCPFPDKVPGTALNTGLFDYVWVQFYN 212          
BLAST of FC931175 vs. ExPASy Swiss-Prot
Match: CHIA_ARATH (Acidic endochitinase OS=Arabidopsis thaliana GN=CHIB1 PE=2 SV=2)

HSP 1 Score: 277.33 bits (708), Expect = 5.642e-76
Identity = 132/197 (67.01%), Postives = 149/197 (75.63%), Query Frame = 1
Query:   61 VTLSLIKASQGA-GGIVIYWGQNGNEGTLTSTCATSKYAYVNIAFLNKFGNGQTPEINLAGHCNPAAGGCRVVSDAIKSCQSRGIKVMXXXXXXXXXXXXXXXXDAKNVADYLWNNFLGGTSSSRPLGAAVLDGIDFDIEQGSTLHWDDLARFLSAYSSRGKKVYLTAAPQCPFPDRFLGAALNTGLFDYVWVQFYN 648
            ++ SL K S  + GGI IYWGQNGNEG L++TCAT +YAYVN+AFL KFGNGQTPE+NLAGHCNPAA  C      +K CQSRGIKVM                DAK +ADYLWNNFLGG SSSRPLG AVLDGIDF+IE GS  HWDDLAR LS +S RG+K+YLT APQCPFPDR +G+ALNT  FDYVW+QFYN
Sbjct:   17 ISCSLSKPSDASRGGIAIYWGQNGNEGNLSATCATGRYAYVNVAFLVKFGNGQTPELNLAGHCNPAANTCTHFGSQVKDCQSRGIKVMLSLGGGIGNYSIGSREDAKVIADYLWNNFLGGKSSSRPLGDAVLDGIDFNIELGSPQHWDDLARTLSKFSHRGRKIYLTGAPQCPFPDRLMGSALNTKRFDYVWIQFYN 213          

HSP 2 Score: 28.8758 bits (63), Expect = 5.642e-76
Identity = 11/14 (78.57%), Postives = 12/14 (85.71%), Query Frame = 3
Query:  648 HPPCQYSSRNTQNL 689
            +PPC YSS NTQNL
Sbjct:  214 NPPCSYSSGNTQNL 227          
BLAST of FC931175 vs. ExPASy Swiss-Prot
Match: CHIA_TOBAC (Acidic endochitinase OS=Nicotiana tabacum PE=1 SV=1)

HSP 1 Score: 254.988 bits (650), Expect = 1.136e-67
Identity = 124/202 (61.39%), Postives = 150/202 (74.26%), Query Frame = 1
Query:   43 TFVSLLVTLSLIKASQGAGGIVIYWGQNGNEGTLTSTCATSKYAYVNIAFLNKFGNGQTPEINLAGHCNPAAGGCRVVSDAIKSCQSRGIKVMXXXXXXXXXXXXXXXXDAKNVADYLWNNFLGGTSSSRPLGAAVLDGIDFDIEQGSTLHWDDLARFLSAYSSRGKKVYLTAAPQCPFPDRFLGAALNTGLFDYVWVQFYN 648
            +F+   + L L      AG IVIYWGQNGNEG+L  TCAT+ YA VNIAFL  FGNGQ P +NLAGHC+P AG C  +S+ I++CQ++GIKVM                DA+NVA+YLWNN+LGG S++RPLG AVLDGIDFDIE G+T HWD+LA+ LS +S + +KVYLTAAPQCPFPD +L  AL+TGLFDYVWVQFYN
Sbjct:    5 SFLLTALVLFLRALKLEAGDIVIYWGQNGNEGSLADTCATNNYAIVNIAFLVVFGNGQNPVLNLAGHCDPNAGACTGLSNDIRACQNQGIKVMLSLGGGAGSYFLSSADDARNVANYLWNNYLGGQSNTRPLGDAVLDGIDFDIEGGTTQHWDELAKTLSQFSQQ-RKVYLTAAPQCPFPDTWLNGALSTGLFDYVWVQFYN 205          

HSP 2 Score: 23.483 bits (49), Expect = 1.136e-67
Identity = 8/14 (57.14%), Postives = 10/14 (71.43%), Query Frame = 3
Query:  648 HPPCQYSSRNTQNL 689
            +PPCQYS  +  NL
Sbjct:  206 NPPCQYSGGSADNL 219          
BLAST of FC931175 vs. ExPASy Swiss-Prot
Match: CHIA_CICAR (Acidic endochitinase OS=Cicer arietinum PE=2 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 1.028e-62
Identity = 113/197 (57.36%), Postives = 143/197 (72.59%), Query Frame = 1
Query:   58 LVTLSLIKASQGAGGIVIYWGQNGNEGTLTSTCATSKYAYVNIAFLNKFGNGQTPEINLAGHCNPAAGGCRVVSDAIKSCQSRGIKVMXXXXXXXXXXXXXXXXDAKNVADYLWNNFLGGTSSSRPLGAAVLDGIDFDIEQGSTLHWDDLARFLSAYSSRGKKVYLTAAPQCPFPDRFLGAALNTGLFDYVWVQFYN 648
            L+ +SL+  S  A GI +YWGQNGNEG+L   C T+ Y +VNIAFL+ FGNGQ P+INLAGHC+P+  GC   S  I++CQ++GIKV+                +A  +A+YLWNNFLGGTS+SRPLG AVLDGIDFDIE G   H+D+LA+ L+ +S   +KVYL+AAPQCP+PD  L +A+ TGLFDYVWVQFYN
Sbjct:   11 LLLISLLIKSSNAAGIAVYWGQNGNEGSLQDACNTNNYQFVNIAFLSTFGNGQNPQINLAGHCDPSTNGCTKFSPEIQACQAKGIKVLLSLGGGAGSYSLNSAEEATTLANYLWNNFLGGTSTSRPLGDAVLDGIDFDIESGGQ-HYDELAKALNGFSQ--QKVYLSAAPQCPYPDAHLDSAIQTGLFDYVWVQFYN 204          

HSP 2 Score: 23.483 bits (49), Expect = 1.028e-62
Identity = 8/15 (53.33%), Postives = 11/15 (73.33%), Query Frame = 3
Query:  648 HPPCQYSSRNTQNLI 692
            +P CQYS+ N  NL+
Sbjct:  205 NPQCQYSNGNINNLV 219          
BLAST of FC931175 vs. ExPASy Swiss-Prot
Match: CHIA_PHAAN (Acidic endochitinase OS=Phaseolus angularis PE=2 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 2.197e-62
Identity = 116/197 (58.88%), Postives = 135/197 (68.53%), Query Frame = 1
Query:   58 LVTLSLIKASQGAGGIVIYWGQNGNEGTLTSTCATSKYAYVNIAFLNKFGNGQTPEINLAGHCNPAAGGCRVVSDAIKSCQSRGIKVMXXXXXXXXXXXXXXXXDAKNVADYLWNNFLGGTSSSRPLGAAVLDGIDFDIEQGSTLHWDDLARFLSAYSSRGKKVYLTAAPQCPFPDRFLGAALNTGLFDYVWVQFYN 648
            L+ +S  K S  AGGI +YWGQNGNEG+L   C T  Y YVNIAFL  FG GQTP++NLAGHCNP+   C V SD IK CQS+ IKV+                DA  VA+Y+WNNFLGG SSSRPLG A+LDG+DFDIE G+  HWDDLAR L  ++S   ++ LTAAPQCP PD  L  A+ TGLFD VWVQFYN
Sbjct:   18 LLFISFFKPSH-AGGISVYWGQNGNEGSLADACNTGNYKYVNIAFLFTFGGGQTPQLNLAGHCNPSINNCNVFSDQIKECQSKDIKVLLSLGGASGSYSLTSADDATQVANYIWNNFLGGQSSSRPLGDAILDGVDFDIESGTGEHWDDLARALKGFNS---QLLLTAAPQCPIPDAHLDTAIKTGLFDIVWVQFYN 210          
BLAST of FC931175 vs. ExPASy Swiss-Prot
Match: CHIB_TOBAC (Basic endochitinase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 4.144e-61
Identity = 116/198 (58.59%), Postives = 139/198 (70.20%), Query Frame = 1
Query:   55 LLVTLSLIKASQGAGGIVIYWGQNGNEGTLTSTCATSKYAYVNIAFLNKFGNGQTPEINLAGHCNPAAGGCRVVSDAIKSCQSRGIKVMXXXXXXXXXXXXXXXXDAKNVADYLWNNFLGGTSSSRPLGAAVLDGIDFDIEQGSTLHWDDLARFLSAYSSRGKKVYLTAAPQCPFPDRFLGAALNTGLFDYVWVQFYN 648
            L + L L+ +   AG IV+YWGQ+  EG L  TC +  Y  VNIAFL+ FGN QTP++NLAGHC P++GGC+ ++ +I+ CQS GIK+M                DA+ VADYLWNNFLGG SS RPLG AVLDGIDFDIE G   H+  LAR LS +  +GKK+YLTAAPQCPFPD+ L  AL TGLFDYVWVQFYN
Sbjct:   11 LPIFLLLLTSKVKAGDIVVYWGQDVGEGKLIDTCNSGLYNIVNIAFLSSFGNFQTPKLNLAGHCEPSSGGCQQLTKSIRHCQSIGIKIMLSIGGGTPTYTLSSVDDARQVADYLWNNFLGGQSSFRPLGDAVLDGIDFDIELGQP-HYIALARRLSEHGQQGKKLYLTAAPQCPFPDKLLNGALQTGLFDYVWVQFYN 207          
BLAST of FC931175 vs. ExPASy Swiss-Prot
Match: CHIA_CUCSA (Acidic endochitinase OS=Cucumis sativus PE=1 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 1.206e-60
Identity = 115/204 (56.37%), Postives = 138/204 (67.65%), Query Frame = 1
Query:   37 IATFVSLLVTLSLIKASQGAGGIVIYWGQNGNEGTLTSTCATSKYAYVNIAFLNKFGNGQTPEINLAGHCNPAAGGCRVVSDAIKSCQSRGIKVMXXXXXXXXXXXXXXXXDAKNVADYLWNNFLGGTSSSRPLGAAVLDGIDFDIEQGSTLHWDDLARFLSAYSSRGKKVYLTAAPQCPFPDRFLGAALNTGLFDYVWVQFYN 648
            I T +S+   LS I  S  A GI IYWGQNGNEG+L STCAT  Y +VNIAFL+ FG+GQ P +NLAGHCNP   GC  +SD I SC+S+ +KV+                DAK VA+++WN++LGG S SRPLGAAVLDG+DFDIE GS   WD LA+ L  +     +V L+AAPQCP PD  L AA+ TGLFD VWVQFYN
Sbjct:    6 ITTTLSIFFLLSSIFRSSDAAGIAIYWGQNGNEGSLASTCATGNYEFVNIAFLSSFGSGQAPVLNLAGHCNPDNNGCAFLSDEINSCKSQNVKVLLSIGGGAGSYSLSSADDAKQVANFIWNSYLGGQSDSRPLGAAVLDGVDFDIESGSGQFWDVLAQELKNFG----QVILSAAPQCPIPDAHLDAAIKTGLFDSVWVQFYN 205          
BLAST of FC931175 vs. ExPASy Swiss-Prot
Match: CHIE_BETVU (Acidic endochitinase SE2 OS=Beta vulgaris GN=SE2 PE=1 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 9.553e-58
Identity = 114/211 (54.03%), Postives = 139/211 (65.88%), Query Frame = 1
Query:   16 MATNSPAIATFVSLLVTLSLIKASQGAGGIVIYWGQNGNEGTLTSTCATSKYAYVNIAFLNKFGNGQTPEINLAGHCNPAAGGCRVVSDAIKSCQSRGIKVMXXXXXXXXXXXXXXXXDAKNVADYLWNNFLGGTSSSRPLGAAVLDGIDFDIEQGSTLHWDDLARFLSAYSSRGKKVYLTAAPQCPFPDRFLGAALNTGLFDYVWVQFYN 648
            MA    ++   +SLL+  S  ++S G+  IVIYWGQNG+EG+L  TC +  Y  V +AF+  FGNGQTP +NLAGHC+PA   C  +S  IK+CQ  GIKV+                DA   ADYLWN +LGG SS+RPLG AVLDGIDFDIE G    WDDLAR L+ +++  K VYL+AAPQCP PD  L  A+ TGLFDYVWVQFYN
Sbjct:    1 MAAKIVSVLFLISLLIFASF-ESSHGSQ-IVIYWGQNGDEGSLADTCNSGNYGTVILAFVATFGNGQTPALNLAGHCDPATN-CNSLSSDIKTCQQAGIKVLLSIGGGAGGYSLSSTDDANTFADYLWNTYLGGQSSTRPLGDAVLDGIDFDIESGDGRFWDDLARALAGHNNGQKTVYLSAAPQCPLPDASLSTAIATGLFDYVWVQFYN 208          
BLAST of FC931175 vs. ExPASy Swiss-Prot
Match: CHI1_RHINI (Chitinase 1 OS=Rhizopus niveus GN=CHI1 PE=3 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 5.279e-32
Identity = 80/211 (37.91%), Postives = 112/211 (53.08%), Query Frame = 1
Query:   49 VSLLVTLSLIKASQGAGGIVIYWGQNG-----NEGTLTSTCATSKYAYVNIAFLNKFGNGQTPEINLAGHC------NPAAGGCRVVSDAIKSCQSRGIKVMXXXXXXXXXXXXXXXXDAKNVADYLWNNFLGGTSSSRPLGAAVLDGIDFDIEQGSTLHWDDLARFLSAYSSRGKKVYLTAAPQCPFPDRFLGAALNTGLFDYVWVQFYN 648
            ++  +T +L   S     ++ YWGQN       +G+L S C + +   + ++FLNKF  G  PEINLA  C      N     C  V   IK+CQS G+KV+                + +  A+ +WN F GGTS +RP   AV+DGID DIE GS+  +   A F++A  S+G    + AAPQCPFPD  LG+ ++    D+V VQFYN
Sbjct:   11 IAAFITSTLAAYSSNGVNVMYYWGQNSAGGSNTQGSLVSYCQSGQVDVIILSFLNKFNMGGLPEINLASACEQTFFPNTNLLHCPTVGSDIKTCQSNGVKVLLSLGGAAGSYGFSSDSEGQTFAETIWNLFGGGTSDTRPFDDAVIDGIDLDIEGGSSTGY---AAFVTALRSKG-HFLIGAAPQCPFPDAILGSVIDAVGLDFVNVQFYN 217          
The following BLAST results are available for this feature:
BLAST of FC931175 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 24
Match NameE-valueIdentityDescription
CHLY_HEVBR3.722e-8673.24Hevamine-A OS=Hevea brasiliensis PE=1 SV=2[more]
CHIT3_VITVI1.675e-7871.43Acidic endochitinase OS=Vitis vinifera GN=CHIT3 PE... [more]
CHIA_ARATH5.642e-7667.01Acidic endochitinase OS=Arabidopsis thaliana GN=CH... [more]
CHIA_TOBAC1.136e-6761.39Acidic endochitinase OS=Nicotiana tabacum PE=1 SV=... [more]
CHIA_CICAR1.028e-6257.36Acidic endochitinase OS=Cicer arietinum PE=2 SV=1[more]
CHIA_PHAAN2.197e-6258.88Acidic endochitinase OS=Phaseolus angularis PE=2 S... [more]
CHIB_TOBAC4.144e-6158.59Basic endochitinase OS=Nicotiana tabacum PE=2 SV=1[more]
CHIA_CUCSA1.206e-6056.37Acidic endochitinase OS=Cucumis sativus PE=1 SV=1[more]
CHIE_BETVU9.553e-5854.03Acidic endochitinase SE2 OS=Beta vulgaris GN=SE2 P... [more]
CHI1_RHINI5.279e-3237.91Chitinase 1 OS=Rhizopus niveus GN=CHI1 PE=3 SV=1[more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34102C07EF PostHarvP1 Citrus clementina cDNA clone C34102C07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931175 ID=FC931175|Name=FC931175|organism=Citrus clementina|type=EST|length=717bp
GGCATAATTGCAGAAATGGCCACAAACTCTCCAGCAATAGCAACATTCGT
CTCCCTGCTGGTCACTCTGTCATTGATCAAAGCCTCTCAAGGCGCCGGCG
GCATCGTAATCTATTGGGGCCAAAACGGCAACGAGGGTACCCTCACTTCA
ACCTGTGCCACAAGCAAATATGCTTATGTCAACATAGCTTTCCTGAACAA
GTTTGGCAACGGCCAGACCCCTGAAATTAACCTTGCCGGCCACTGCAACC
CTGCAGCCGGTGGCTGCAGAGTCGTCAGCGACGCAATCAAGAGTTGTCAG
AGCCGAGGCATCAAAGTTATGCTTTCCCTCGGAGGTGGGGTTGGTAGCTA
CTCTTTGGCTTCTGTAGCTGATGCCAAGAATGTAGCTGATTACTTGTGGA
ACAATTTCTTGGGGGGAACATCAAGTTCAAGGCCATTAGGTGCTGCTGTG
TTGGACGGTATTGATTTTGATATTGAGCAAGGCTCAACTTTGCATTGGGA
TGACCTTGCAAGGTTTCTATCAGCATATAGCAGCCGTGGCAAGAAAGTTT
ACTTAACAGCAGCTCCCCAGTGCCCATTTCCTGATAGGTTTCTGGGTGCT
GCTTTGAACACGGGGCTTTTTGATTATGTATGGGTTCAGTTTTACAACAC
CCACCTTGTCAGTATAGTTCACGAAATACCCAGAATCTTATAGTTCATTT
ACAGATGGGCTTCATCA
back to top