FC931179

Overview
NameFC931179
Unique NameFC931179
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length724
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931179 vs. ExPASy Swiss-Prot
Match: OPT3_ARATH (Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=2)

HSP 1 Score: 421.009 bits (1081), Expect = 1.368e-118
Identity = 195/221 (88.24%), Postives = 210/221 (95.02%), Query Frame = 3
Query:    9 LFAFALAWIVTLPIGVIQATTNQQPGYDIIAQFMIGYVLPGKPIANLLFKIYGRISTIHALSFLSDLKLGHYMKIPPRCMYTAQLVGTIVSGVVNLGVAWWMLESIENICDVESLHPDSQWTCPKYRVTFDASVIWGLIGPRRLFGPGGMYRNLVWLFLVGAVLPVPVWVLSKVFPEKKWIPLINIPVISYGFAGMPPATPTNIASWLITGMIFNYFVFRY 671
            LFAFALA+IVTLPIGVIQATTNQQPGYDII QF+IGY+LPGKPIANL+FKIYGRIST+HALSFL+DLKLGHYMKIPP CMYTAQLVGT+V+GVVNLGVAWWMLESI++ICD+E  HP+S WTCPKYRVTFDASVIWGLIGPRRLFGPGGMYRNLV  FL+GAVLPVPVW LSK+FP KKWIPLINIPVISYGFAGMPPATPTNIASWL+TG IFNYFVF Y
Sbjct:  450 LFAFALAFIVTLPIGVIQATTNQQPGYDIIGQFIIGYILPGKPIANLIFKIYGRISTVHALSFLADLKLGHYMKIPPPCMYTAQLVGTVVAGVVNLGVAWWMLESIQDICDIEGDHPNSPWTCPKYRVTFDASVIWGLIGPRRLFGPGGMYRNLVGFFLIGAVLPVPVWALSKIFPNKKWIPLINIPVISYGFAGMPPATPTNIASWLVTGTIFNYFVFNY 670          

HSP 2 Score: 27.335 bits (59), Expect = 1.368e-118
Identity = 8/11 (72.73%), Postives = 9/11 (81.82%), Query Frame = 2
Query:  671 HKRWWQKYTMI 703
            HKRWWQKY  +
Sbjct:  671 HKRWWQKYNYV 681          
BLAST of FC931179 vs. ExPASy Swiss-Prot
Match: OPT4_ARATH (Oligopeptide transporter 4 OS=Arabidopsis thaliana GN=OPT4 PE=2 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 8.669e-75
Identity = 127/221 (57.47%), Postives = 163/221 (73.76%), Query Frame = 3
Query:    9 LFAFALAWIVTLPIGVIQATTNQQPGYDIIAQFMIGYVLPGKPIANLLFKIYGRISTIHALSFLSDLKLGHYMKIPPRCMYTAQLVGTIVSGVVNLGVAWWMLESIENICDVESLHPDSQWTCPKYRVTFDASVIWGLIGPRRLFGPGGMYRNLVWLFLVGAVLPVPVWVLSKVFPEKKWIPLINIPVISYGFAGMPPATPTNIASWLITGMIFNYFVFRY 671
            +FA A+A++ TLPI +I ATTNQ PG +II ++ +G + PG+PIAN+ FK+YG +S   A+SFL+D KLGHYMKIPPR M+  Q +GTI++G +N+ VAWW L SI+NIC  E L P+S WTCP  RV FDASVIWGL+GP+R+FG  G Y  + W FL GA+ PV VW L K FP++ WIPL+N+PV+    A MPPAT  N  SW++ G IFN FVFRY
Sbjct:  442 VFASAMAFVFTLPISIITATTNQTPGLNIITEYAMGLIYPGRPIANVCFKVYGYMSMAQAVSFLNDFKLGHYMKIPPRSMFLVQFIGTILAGTINITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYAAMNWFFLGGALGPVIVWSLHKAFPKRSWIPLVNLPVLLGATAMMPPATAVNYNSWILVGTIFNLFVFRY 662          
BLAST of FC931179 vs. ExPASy Swiss-Prot
Match: OPT2_ARATH (Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2)

HSP 1 Score: 272.322 bits (695), Expect = 1.808e-72
Identity = 125/221 (56.56%), Postives = 159/221 (71.95%), Query Frame = 3
Query:    9 LFAFALAWIVTLPIGVIQATTNQQPGYDIIAQFMIGYVLPGKPIANLLFKIYGRISTIHALSFLSDLKLGHYMKIPPRCMYTAQLVGTIVSGVVNLGVAWWMLESIENICDVESLHPDSQWTCPKYRVTFDASVIWGLIGPRRLFGPGGMYRNLVWLFLVGAVLPVPVWVLSKVFPEKKWIPLINIPVISYGFAGMPPATPTNIASWLITGMIFNYFVFRY 671
            L A  +A   T+P+ +I ATTNQ PG +II ++++G +LPG+PIAN+ FK YG IS   A+SFL+D KLGHYMKIPPR M+  Q +GT+++G VN+ VAW++L S+ENIC  E L P+S WTCP  RV FDASVIWGL+GP+R+FG  G Y  L W FL G + PV VW+L K FP K WI  IN+PV+    A MPPAT  N   W+I G+IFNYFVF+Y
Sbjct:  446 LLASFMALTFTVPVSIITATTNQTPGLNIITEYLMGVLLPGRPIANVCFKTYGYISMSQAISFLNDFKLGHYMKIPPRSMFLVQFIGTVIAGTVNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDASVIWGLVGPKRIFGRLGNYPALNWFFLGGLIGPVLVWLLQKAFPTKTWISQINLPVLLGATAAMPPATSVNFNCWIIVGVIFNYFVFKY 666          
BLAST of FC931179 vs. ExPASy Swiss-Prot
Match: OPT6_ARATH (Oligopeptide transporter 6 OS=Arabidopsis thaliana GN=OPT6 PE=2 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 1.530e-71
Identity = 126/224 (56.25%), Postives = 160/224 (71.43%), Query Frame = 3
Query:    9 LFAFALAWIVTLPIGVIQATTNQQPGYDIIAQFMIGYVLPGKPIANLLFKIYGRISTIHALSFLSDLKLGHYMKIPPRCMYTAQLVGTIVSGVVNLGVAWWMLESIENICDVESLHPDSQWTCPKYRVTFDASVIWGLIGPRRLFGPGGMYRNLVWLFLVGAVLPVPVWVLSKVFPEKKWIPLINIPVISYGFAGMPPATPTNIASWLITGMIFNYFVFRYTSV 680
            L A A+A   T  IGVI ATTNQ PG +II +++IGY+ P +P+AN+ FK+YG IS   AL+F+SD KLGHYMKIPPR M+ AQ+ GT+V+ VV  G AWW++E I ++CD   L  DSQWTCP  RV FDASVIWGL+GPRR+FG  G Y N+ W FLVGA+ P+ VW+ +K+FP + WI  I+IPV+    A MPPAT  N  SWLI   IF +F+F+Y  V
Sbjct:  447 LLACAIAISFTPLIGVIAATTNQAPGLNIITEYVIGYIYPERPVANMCFKVYGYISMTQALTFISDFKLGHYMKIPPRSMFMAQVAGTLVAVVVYTGTAWWLMEEIPHLCDTSLLPSDSQWTCPMDRVFFDASVIWGLVGPRRVFGDLGEYSNVNWFFLVGAIAPLLVWLATKMFPAQTWIAKIHIPVLVGATAMMPPATAVNFTSWLIVAFIFGHFIFKYRRV 670          
BLAST of FC931179 vs. ExPASy Swiss-Prot
Match: OPT7_ARATH (Oligopeptide transporter 7 OS=Arabidopsis thaliana GN=OPT7 PE=2 SV=1)

HSP 1 Score: 263.077 bits (671), Expect = 1.097e-69
Identity = 119/221 (53.85%), Postives = 162/221 (73.30%), Query Frame = 3
Query:    9 LFAFALAWIVTLPIGVIQATTNQQPGYDIIAQFMIGYVLPGKPIANLLFKIYGRISTIHALSFLSDLKLGHYMKIPPRCMYTAQLVGTIVSGVVNLGVAWWMLESIENICDVESLHPDSQWTCPKYRVTFDASVIWGLIGPRRLFGPGGMYRNLVWLFLVGAVLPVPVWVLSKVFPEKKWIPLINIPVISYGFAGMPPATPTNIASWLITGMIFNYFVFRY 671
            L A  +A I TLPIG+I A TNQ PG +II +++IGY+ PG P+AN+ FK+YG IS   A++FL D KLGHYMKIPPR M+ AQ+VGT++S  V L  AWW++E+I NICD  +   +S WTCP  +V +DASVIWGLIGPRR+FG  G+Y+++ W FLVGA+ P+ VW+ S++FP ++WI LIN+PV+    + MPPAT  N  +W++ G +  + VFRY
Sbjct:  481 LLACTVAIIFTLPIGIITAITNQAPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMQQAITFLQDFKLGHYMKIPPRTMFMAQIVGTLISCFVYLTTAWWLMETIPNICDSVT---NSVWTCPSDKVFYDASVIWGLIGPRRIFGDLGLYKSVNWFFLVGAIAPILVWLASRMFPRQEWIKLINMPVLISATSSMPPATAVNYTTWVLAGFLSGFVVFRY 698          
BLAST of FC931179 vs. ExPASy Swiss-Prot
Match: OPT1_ARATH (Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1)

HSP 1 Score: 256.144 bits (653), Expect = 1.341e-67
Identity = 116/220 (52.73%), Postives = 153/220 (69.55%), Query Frame = 3
Query:    9 LFAFALAWIVTLPIGVIQATTNQQPGYDIIAQFMIGYVLPGKPIANLLFKIYGRISTIHALSFLSDLKLGHYMKIPPRCMYTAQLVGTIVSGVVNLGVAWWMLESIENICDVESLHPDSQWTCPKYRVTFDASVIWGLIGPRRLFGPGGMYRNLVWLFLVGAVLPVPVWVLSKVFPEKKWIPLINIPVISYGFAGMPPATPTNIASWLITGMIFNYFVFR 668
            + A A+A   TLPIGVIQATTNQQ G ++I + +IGY+ PGKP+AN+ FK YG IS   AL F+ D KLGHYMKIPPR M+  QLV T+V+  V  G  WW++ S+ENIC+V+ L   S WTCP   V ++AS+IWG+IGP R+F   G+Y  + W FL+G + PVP W LSK FPEKKW+  I++P+I    + MP A   +  SW I G++FNY++FR
Sbjct:  466 ILACAIALFFTLPIGVIQATTNQQMGLNVITELIIGYLYPGKPLANVAFKTYGYISMSQALYFVGDFKLGHYMKIPPRSMFIVQLVATVVASTVCFGTTWWLITSVENICNVDLLPVGSPWTCPGDEVFYNASIIWGVIGPGRMFTKEGIYPGMNWFFLIGLLAPVPFWYLSKKFPEKKWLKQIHVPLIFSAVSAMPQAKAVHYWSWAIVGVVFNYYIFR 685          
BLAST of FC931179 vs. ExPASy Swiss-Prot
Match: OPT8_ARATH (Oligopeptide transporter 8 OS=Arabidopsis thaliana GN=OPT8 PE=2 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 6.653e-67
Identity = 118/219 (53.88%), Postives = 153/219 (69.86%), Query Frame = 3
Query:   15 AFALAWIVTLPIGVIQATTNQQPGYDIIAQFMIGYVLPGKPIANLLFKIYGRISTIHALSFLSDLKLGHYMKIPPRCMYTAQLVGTIVSGVVNLGVAWWMLESIENICDVESLHPDSQWTCPKYRVTFDASVIWGLIGPRRLFGPGGMYRNLVWLFLVGAVLPVPVWVLSKVFPEKKWIPLINIPVISYGFAGMPPATPTNIASWLITGMIFNYFVFRY 671
            A  +A   T  +GVI ATTNQ PG +II +++IGY  P +P+AN+ FK YG IS   +L+FLSDLKLG YMKIPPR M+ AQ+VGT+V+ +   G AWW++  I N+CD   L P SQWTCP  RV FDASVIWGL+GPRR+FG  G Y N+ W F+ GA+ P  V++ S++FP KKWI  I+IPV+    A MPPA+  N  SWL+   +F +FVF+Y
Sbjct:  448 ACLIAIFFTPLVGVIMATTNQAPGLNIITEYIIGYAYPERPVANICFKTYGYISMSQSLTFLSDLKLGTYMKIPPRTMFMAQVVGTLVAVIAYAGTAWWLMAEIPNLCDTNLLPPGSQWTCPSDRVFFDASVIWGLVGPRRMFGDLGEYSNINWFFVGGAIAPALVYLASRLFPNKKWISDIHIPVLIGATAIMPPASAVNFTSWLVMAFVFGHFVFKY 666          
BLAST of FC931179 vs. ExPASy Swiss-Prot
Match: OPT9_ARATH (Oligopeptide transporter 9 OS=Arabidopsis thaliana GN=OPT9 PE=2 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 8.689e-67
Identity = 118/221 (53.39%), Postives = 153/221 (69.23%), Query Frame = 3
Query:    9 LFAFALAWIVTLPIGVIQATTNQQPGYDIIAQFMIGYVLPGKPIANLLFKIYGRISTIHALSFLSDLKLGHYMKIPPRCMYTAQLVGTIVSGVVNLGVAWWMLESIENICDVESLHPDSQWTCPKYRVTFDASVIWGLIGPRRLFGPGGMYRNLVWLFLVGAVLPVPVWVLSKVFPEKKWIPLINIPVISYGFAGMPPATPTNIASWLITGMIFNYFVFRY 671
            L A A+A   T  IGVI ATTNQ+PG ++I +++IGY+ P +P+AN+ FK+YG IS   AL+F+ D KLG YMKIPPR M+ AQ+VGT+VS VV  G AWW++  I ++CD   L PDS+WTCP  RV FDASVIWGL+GPRR+FG  G Y  + W FLVGA+ P  VW+ +K FP  KWI  I+ PVI    + MPPA   N  SW I   +F +F+++Y
Sbjct:  452 LLACAIAVFFTPLIGVIAATTNQEPGLNVITEYVIGYLYPERPVANMCFKVYGYISMTQALTFIQDFKLGLYMKIPPRSMFMAQVVGTLVSVVVYTGTAWWLMVDIPHLCDKSLLPPDSEWTCPMDRVFFDASVIWGLVGPRRMFGNLGEYAAINWFFLVGAIAPFFVWLATKAFPAHKWISKIHFPVILGATSMMPPAMAVNFTSWCIVAFVFGHFLYKY 672          
BLAST of FC931179 vs. ExPASy Swiss-Prot
Match: OPT5_ARATH (Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 5.632e-66
Identity = 114/220 (51.82%), Postives = 153/220 (69.55%), Query Frame = 3
Query:    9 LFAFALAWIVTLPIGVIQATTNQQPGYDIIAQFMIGYVLPGKPIANLLFKIYGRISTIHALSFLSDLKLGHYMKIPPRCMYTAQLVGTIVSGVVNLGVAWWMLESIENICDVESLHPDSQWTCPKYRVTFDASVIWGLIGPRRLFGPGGMYRNLVWLFLVGAVLPVPVWVLSKVFPEKKWIPLINIPVISYGFAGMPPATPTNIASWLITGMIFNYFVFR 668
            L A A+A+  TLPIGVI ATTNQ+ G ++I++ +IG++ PGKP+AN+ FK YG +S   AL F+ D KLGHYMKIPPR M+  QLV TIV+  V+ G  WW+L S+ENIC+ + L   S WTCP   V ++AS+IWG+IGP R+F   G+Y  + W FL+G + PVPVW  ++ FPEKKWI  I+IP+I  G   MP A   +  SW   G++FNY++FR
Sbjct:  464 LLACAIAFTFTLPIGVILATTNQRMGLNVISELIIGFLYPGKPLANVAFKTYGSVSIAQALYFVGDFKLGHYMKIPPRSMFIVQLVATIVASTVSFGTTWWLLSSVENICNTDMLPKSSPWTCPGDVVFYNASIIWGIIGPGRMFTSKGIYPGMNWFFLIGFLAPVPVWFFARKFPEKKWIHQIHIPLIFSGANVMPMAKAVHYWSWFAVGIVFNYYIFR 683          
BLAST of FC931179 vs. ExPASy Swiss-Prot
Match: OPT_SCHPO (Uncharacterized oligopeptide transporter C29B12.10c OS=Schizosaccharomyces pombe GN=SPAC29B12.10c PE=1 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 3.433e-47
Identity = 98/219 (44.75%), Postives = 129/219 (58.90%), Query Frame = 3
Query:    9 LFAFALAWIVT-LPIGVIQATTNQQPGYDIIAQFMIGYVLPGKPIANLLFKIYGRISTIHALSFLSDLKLGHYMKIPPRCMYTAQLVGTIVSGVVNLGVAWWMLESIENICDVESLHPDSQWTCPKYRVTFDASVIWGLIGPRRLFGPGGMYRNLVWLFLVGAVLPVPVWVLSKVFPEKKWIPLINIPVISYGFAGMPPATPTNIASWLITGMIFNYFV 662
            L    L +IV  +P GV++  TNQ  G +II + + GY+LPGKP+ANL+ K+YG I     L F  DLKL  YMKIPPR ++  QL  TI+ G+  + V  WM   I  IC        + +TCP  R  ++AS+IWG IGP ++F  G  Y  L++ FL+GAV P   W L K FP K WI  +N PV+  G   +PPAT  N +SW I G IFNY +
Sbjct:  563 LIVALLIFIVNFIPQGVLEGITNQHVGLNIITELIGGYILPGKPLANLMIKLYGFIPMRQGLEFSRDLKLAQYMKIPPRILFFVQLFATILGGITQVAVQEWMNYHIPGICTTSQ---SNGFTCPNGRSIYNASLIWGAIGPAKMFSKGKPYYPLIFFFLIGAVAPFITWGLRKRFP-KSWIGKLNAPVLFTGPGNIPPATGINYSSWAIVGFIFNYVI 777          
The following BLAST results are available for this feature:
BLAST of FC931179 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 14
Match NameE-valueIdentityDescription
OPT3_ARATH1.368e-11888.24Oligopeptide transporter 3 OS=Arabidopsis thaliana... [more]
OPT4_ARATH8.669e-7557.47Oligopeptide transporter 4 OS=Arabidopsis thaliana... [more]
OPT2_ARATH1.808e-7256.56Oligopeptide transporter 2 OS=Arabidopsis thaliana... [more]
OPT6_ARATH1.530e-7156.25Oligopeptide transporter 6 OS=Arabidopsis thaliana... [more]
OPT7_ARATH1.097e-6953.85Oligopeptide transporter 7 OS=Arabidopsis thaliana... [more]
OPT1_ARATH1.341e-6752.73Oligopeptide transporter 1 OS=Arabidopsis thaliana... [more]
OPT8_ARATH6.653e-6753.88Oligopeptide transporter 8 OS=Arabidopsis thaliana... [more]
OPT9_ARATH8.689e-6753.39Oligopeptide transporter 9 OS=Arabidopsis thaliana... [more]
OPT5_ARATH5.632e-6651.82Oligopeptide transporter 5 OS=Arabidopsis thaliana... [more]
OPT_SCHPO3.433e-4744.75Uncharacterized oligopeptide transporter C29B12.10... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34102C11EF PostHarvP1 Citrus clementina cDNA clone C34102C11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931179 ID=FC931179|Name=FC931179|organism=Citrus clementina|type=EST|length=724bp
GGAGGAAGCTCTTTGCTTTTGCCTTGGCTTGGATTGTTACCCTTCCCATT
GGGGTCATTCAAGCAACTACCAACCAGCAACCTGGATATGACATCATAGC
ACAATTCATGATCGGGTATGTTCTACCAGGAAAACCAATTGCAAATCTGC
TTTTCAAGATTTACGGACGAATCAGTACCATCCATGCTCTATCTTTCTTA
TCTGACCTTAAACTTGGGCACTACATGAAAATTCCTCCACGGTGCATGTA
CACTGCTCAGCTGGTTGGTACTATAGTGTCTGGTGTGGTGAACCTTGGAG
TGGCATGGTGGATGTTGGAGAGCATTGAGAACATTTGTGACGTCGAATCA
CTTCATCCCGACAGCCAATGGACTTGCCCCAAGTACAGAGTAACATTTGA
TGCTTCAGTAATATGGGGTCTGATTGGACCAAGACGGTTGTTTGGTCCTG
GAGGAATGTACCGTAATTTGGTATGGCTATTCCTCGTAGGAGCCGTCTTG
CCAGTTCCTGTTTGGGTACTGAGCAAAGTGTTCCCTGAAAAGAAATGGAT
TCCTTTGATAAACATTCCCGTTATATCCTATGGCTTTGCCGGAATGCCAC
CAGCAACTCCCACCAACATAGCAAGCTGGCTTATCACCGGAATGATCTTC
AACTACTTTGTGTTCCGATACACAAGCGTTGGTGGCAGAAGTATACTATG
ATCTGTCAGCAGCTCTGGATGCTG
back to top