FC931181

Overview
NameFC931181
Unique NameFC931181
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length719
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC931181_ssr561 microsatellite FC931181_ssr561:561..572. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig14471 contig Ccv1_Contig14471:4..722. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931181 vs. ExPASy Swiss-Prot
Match: P2_ARATH (Probable NADP-dependent oxidoreductase P2 OS=Arabidopsis thaliana GN=P2 PE=2 SV=2)

HSP 1 Score: 326.635 bits (836), Expect = 8.013e-89
Identity = 158/226 (69.91%), Postives = 190/226 (84.07%), Query Frame = 1
Query:   46 SNKQVILSNYVTGFPKESDMKIITGSINLKVPEGSKDTVLLKNLYLSCDPYMRGRMSKLDKPSFVA-SFNPGEPLSGYGVSKVLDSTHPNYKKDDLVWGLTSWEEYSLIQSPQHL-IKILDTNVPLSYYTGILGMPGLTAYGGLYELCSPKKGEYVYVSAASGAVGQLVGQFAKLVGCYVVGSAGSKEKVNLLKNKFGFDDAFNYKKEPDLDAALKRCFPEGIDIY 717
            +NKQVI  ++V+GFPKESD    T ++ L+VPEGSK +VL+KNLYLSCDPYMR RM K D  S +A ++ PG+P+ GYGVS+V++S HP+YKK DL+WG+  WEEYS+I    H+  KI  T+VPLSYYTG+LGMPG+TAY G YE+CSPKKGE VYVSAASGAVGQLVGQFAK++GCYVVGSAGSKEKV+LLK KFGFDDAFNYK+E DL AALKRCFP+GID+Y
Sbjct:    3 TNKQVIFKDHVSGFPKESDFNFTTTTVELRVPEGSK-SVLVKNLYLSCDPYMRSRMGKPDPSSALAQAYAPGKPIYGYGVSRVIESGHPDYKKGDLLWGIVGWEEYSVITPMAHMHFKIQHTDVPLSYYTGLLGMPGMTAYAGFYEVCSPKKGETVYVSAASGAVGQLVGQFAKMMGCYVVGSAGSKEKVDLLKTKFGFDDAFNYKEESDLSAALKRCFPKGIDMY 227          
BLAST of FC931181 vs. ExPASy Swiss-Prot
Match: P1_ARATH (Probable NADP-dependent oxidoreductase P1 OS=Arabidopsis thaliana GN=P1 PE=1 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 2.850e-86
Identity = 156/228 (68.42%), Postives = 188/228 (82.46%), Query Frame = 1
Query:   46 SNKQVILSNYVTGFPKESDMKIITGSINLKVPEGSKDTVLLKNLYLSCDPYMRGRMSKLDKPSFVA---SFNPGEPLSGYGVSKVLDSTHPNYKKDDLVWGLTSWEEYSLIQSPQHL-IKILDTNVPLSYYTGILGMPGLTAYGGLYELCSPKKGEYVYVSAASGAVGQLVGQFAKLVGCYVVGSAGSKEKVNLLKNKFGFDDAFNYKKEPDLDAALKRCFPEGIDIY 717
            +NKQVIL +YV+GFP ESD    T ++ L+VPEG+ ++VL+KNLYLSCDPYMR RM K D PS  A   ++ PG+P+ GYGVS++++S HP+YKK DL+WG+ +WEEYS+I    H   KI  T+VPLSYYTG+LGMPG+TAY G YE+CSPK+GE VYVSAASGAVGQLVGQ AK++GCYVVGSAGSKEKV+LLK KFGFDDAFNYK+E DL AALKRCFP GIDIY
Sbjct:    4 TNKQVILKDYVSGFPTESDFDFTTTTVELRVPEGT-NSVLVKNLYLSCDPYMRIRMGKPD-PSTAALAQAYTPGQPIQGYGVSRIIESGHPDYKKGDLLWGIVAWEEYSVITPMTHAHFKIQHTDVPLSYYTGLLGMPGMTAYAGFYEVCSPKEGETVYVSAASGAVGQLVGQLAKMMGCYVVGSAGSKEKVDLLKTKFGFDDAFNYKEESDLTAALKRCFPNGIDIY 229          
BLAST of FC931181 vs. ExPASy Swiss-Prot
Match: YFMJ_BACSU (Putative NADP-dependent oxidoreductase yfmJ OS=Bacillus subtilis GN=yfmJ PE=2 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.934e-42
Identity = 103/225 (45.78%), Postives = 136/225 (60.44%), Query Frame = 1
Query:   46 SNKQVILSNYVTGFPKESDMKIITGSINLKVPEGSKDTVLLKNLYLSCDPYMRGRMSKLDKPSFVASFNPGEPLSGYGVSKVL-DSTHPNYKKDDLVWGLTSWEEYSLIQSPQHLIKILDTNVPLSYYTGILGMPGLTAYGGLYELCSPKKGEYVYVSAASGAVGQLVGQFAKLVGCYVVGSAGSKEKVNLLKNKFGFDDAFNYKKEPDLDAALKRCFPEGIDIY 717
            S +Q+ L+    G P   D +  T    + VPE  +  VL+K LY+S DPYMRGRM   D  S+V  F   + LSG  +++V+ D  H   KK D+V G  SW+E+S + S   L KI  +  P S Y GILGM GLTAY GL ++  PK+GE V VS A+GAVG  VGQ AK+ G  VVG AGS EK++ LK +  FD+A NYK   D+  AL+   P+G+D+Y
Sbjct:    4 SQQQIQLARRPQGIPVHEDFRFET----IPVPEPKQGEVLVKTLYVSVDPYMRGRMQ--DTKSYVEPFALDKALSGGVIAEVVSDGNH--LKKGDIVIGNLSWQEFSAV-SESALRKIDTSLAPASAYLGILGMTGLTAYFGLLDIGRPKEGETVVVSGAAGAVGSTVGQIAKIKGARVVGIAGSDEKIDYLKQELQFDEAINYKTADDIQKALQNACPDGVDVY 219          
BLAST of FC931181 vs. ExPASy Swiss-Prot
Match: PTGR1_RABIT (Prostaglandin reductase 1 OS=Oryctolagus cuniculus GN=PTGR1 PE=2 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 5.450e-37
Identity = 95/228 (41.67%), Postives = 133/228 (58.33%), Query Frame = 1
Query:   43 VSNKQVILSNYVTGFPKESDMKIITGSINLKVPEGSKDTVLLKNLYLSCDPYMRGRMSKLDKPSFVASFNPGEPLSGYGVSKVLDSTHPNYKKDDLVWGLTSWEEYSLIQSPQHLIKILDT---NVPLSYYTGILGMPGLTAYGGLYELCSPKKGEYVYVSAASGAVGQLVGQFAKLVGCYVVGSAGSKEKVNLLKNKFGFDDAFNYKKEPDLDAALKRCFPEGIDIY 717
            V  K   L  +  G P +SD ++ T    +++P  +   VLL+ L+LS DPYMR    +L +         G+ + G  V++V++S +P +    LV   + W  +S I   Q L K+L      +PLS   G +GMPG+TAY GL E+C  K G+ V V+AA+GAVG +VGQ AK+ GC VVG+AGS+EKV+ LK K GFD AFNYK    L+  LK+  P+G D Y
Sbjct:    2 VRAKNWTLKKHFHGHPTDSDFELKT----VELPPLNNGEVLLEALFLSVDPYMRLGSKRLKE---------GDTMMGQQVARVVESKNPAWPVGTLVLAHSGWASHS-ISDGQQLEKLLTEWPDTLPLSLALGTVGMPGITAYFGLLEICGAKSGDTVLVNAAAGAVGAVVGQIAKIKGCRVVGAAGSEEKVDYLK-KIGFDFAFNYKTVKSLEETLKKAAPDGYDCY 214          
BLAST of FC931181 vs. ExPASy Swiss-Prot
Match: YNCB_ECOLI (Putative NADP-dependent oxidoreductase yncB OS=Escherichia coli (strain K12) GN=yncB PE=3 SV=3)

HSP 1 Score: 152.525 bits (384), Expect = 2.071e-36
Identity = 90/229 (39.30%), Postives = 130/229 (56.77%), Query Frame = 1
Query:   31 GEEAVSNKQVILSNYVTGFPKESDMKIITGSINLKVPEGSKDTVLLKNLYLSCDPYMRGRMSKLDKPSFVASFNPGEPLSGYGVSKVLDSTHPNYKKDDLVWGLTSWEEYSLIQSPQHLIKILDTNVPLSYYTGILGMPGLTAYGGLYELCSPKKGEYVYVSAASGAVGQLVGQFAKLVGCYVVGSAGSKEKVNLLKNKFGFDDAFNYKKEPDLDAALKRCFPEGIDIY 717
            G++   N++ +L++   G P   + ++        V    +  VLL+ +YLS DPYMRGRMS  D+PS+    + G  + G  VS+V++S HP+Y+  D V G + W++Y  I S   L+K+ D     S+  G+LGMPG TAY GL ++  PK+GE + V+AA+G VG  VGQ  KL GC VVG AG  EK        GFD   ++  +   +   K C P+GIDIY
Sbjct:    2 GQQKQRNRRWVLASRPHGAPVPENFRLEEDD----VATPGEGQVLLRTVYLSLDPYMRGRMS--DEPSYSPPVDIGGVMVGGTVSRVVESNHPDYQSGDWVLGYSGWQDYD-ISSGDDLVKLGDHPQNPSWSLGVLGMPGFTAYMGLLDIGQPKEGETLVVAAATGPVGATVGQIGKLKGCRVVGVAGGAEKCRHATEVLGFDVCLDHHADDFAEQLAKAC-PKGIDIY 222          
BLAST of FC931181 vs. ExPASy Swiss-Prot
Match: PTGR1_MOUSE (Prostaglandin reductase 1 OS=Mus musculus GN=Ptgr1 PE=2 SV=2)

HSP 1 Score: 150.599 bits (379), Expect = 7.870e-36
Identity = 96/228 (42.11%), Postives = 128/228 (56.14%), Query Frame = 1
Query:   43 VSNKQVILSNYVTGFPKESDMKIITGSINLKVPEGSKDTVLLKNLYLSCDPYMRGRMSKLDKPSFVASFNPGEPLSGYGVSKVLDSTHPNYKKDDLVWGLTSWEEYSLIQSPQHLIKI---LDTNVPLSYYTGILGMPGLTAYGGLYELCSPKKGEYVYVSAASGAVGQLVGQFAKLVGCYVVGSAGSKEKVNLLKNKFGFDDAFNYKKEPDLDAALKRCFPEGIDIY 717
            V  K   L  +  GFP + + ++ T     ++P  +   VLL+ L+LS DPYMR    KL +         G+ + G  V++V++S +  + K  +V  L  W  +S I     L K+       +PLS   G +GMPGLTAY GL ++C  K GE V VSAA+GAVG +VGQ AKL GC VVG+AGS EKV  LK K GFD AFNYK    L+ AL+   P+G D Y
Sbjct:    2 VQAKSWTLKKHFEGFPTDGNFELKT----TELPPLNNGEVLLEALFLSVDPYMRVAAKKLKE---------GDRMMGEQVARVVESKNSAFPKGTIVAALLGWTSHS-ISDGNGLTKLPVEWPDKLPLSLALGTVGMPGLTAYFGLLDICGVKGGETVMVSAAAGAVGSVVGQIAKLKGCKVVGTAGSDEKVAYLK-KLGFDVAFNYKTVKSLEEALRTASPDGYDCY 214          
BLAST of FC931181 vs. ExPASy Swiss-Prot
Match: YKM8_SCHPO (Zinc-type alcohol dehydrogenase-like protein PB24D3.08c OS=Schizosaccharomyces pombe GN=SPAPB24D3.08c PE=2 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 1.028e-35
Identity = 98/234 (41.88%), Postives = 132/234 (56.41%), Query Frame = 1
Query:   43 VSNKQVILSNYV---TGFPKESD-MKIITGSINLKVPEGSKDT-VLLKNLYLSCDPYMRGRMSKLDKPSFVASFNPGEPLSGYGVSKVLDSTHPNYKKDDLVWGLTSWEEYSLIQSPQHLIKILDTN----VPLSYYTGILGMPGLTAYGGLYELCSPKKGEYVYVSAASGAVGQLVGQFAKLVGCYVVGSAGSKEKVNLLKNKFGFDDAFNYKKEPDLDAALKRCFPEGIDIY 717
            VSN  VI+  Y+    G+P   + +       +L+  +  ++T VLLKN+Y S DPY+R RM      S++     G+P     V+KV+ ST   YK    V  ++ WEEY+ + S Q L  +   N    +PL  + G LGMP  TAY GL  +  PK GE +Y+SAASGAVGQ+ GQ AK +G +VVGS GS EK  +  +  G+D  FNYKKE     AL R  P+GIDIY
Sbjct:    2 VSNNAVIIKKYLDSTAGYPVIGEHLAFEKREFDLENAQVDEETPVLLKNIYTSVDPYLRMRMQSPKHASYIPPLELGKPFYNSTVAKVVKSTLDQYKPGMDVVFVSGWEEYTFV-SKQALGFLQPINNPYKLPLIDFVGSLGMPSQTAYCGLKHIGKPKAGETIYISAASGAVGQMAGQLAKAMGLHVVGSVGSDEKFKICLDS-GYDSVFNYKKESPF-KALPRLCPKGIDIY 232          
BLAST of FC931181 vs. ExPASy Swiss-Prot
Match: PTGR1_BOVIN (Prostaglandin reductase 1 OS=Bos taurus GN=PTGR1 PE=2 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 1.028e-35
Identity = 98/229 (42.79%), Postives = 129/229 (56.33%), Query Frame = 1
Query:   43 VSNKQVILSNYVTGFPKESDMKIITGSINLKVPEGSKDTVLLKNLYLSCDPYMRGRMSKLDKPSFVASFNPGEPLSGYGVSKVLDSTHPNYKKDDLVWGLTSWEEYSLIQSPQHLIKIL----DTNVPLSYYTGILGMPGLTAYGGLYELCSPKKGEYVYVSAASGAVGQLVGQFAKLVGCYVVGSAGSKEKVNLLKNKFGFDDAFNYKKEPDLDAALKRCFPEGIDIY 717
            V  K   L  +  G+P  SD ++ T    +++P      VLL+ LYL+ DPYMR             S   G+ + G  V++V++S +  +    +V   + W  +S I + + L K+L    DT +PLS   G +GMPGLTAY GL ++C  K GE V VSAA+GAVG +VGQ AKL GC VVG+AGS EKV  LK K GFD A NYK    L+ ALK   PEG D Y
Sbjct:    2 VHAKSWTLKKHFVGYPTNSDFELKT----VELPPLKDGEVLLEALYLTVDPYMR---------IMAKSLKEGDMMMGEQVARVVESKNSAFPTGTIVLAPSGWTTHS-ISNGEKLEKVLAEWPDT-LPLSLALGTVGMPGLTAYFGLLDICGVKGGETVLVSAAAGAVGSIVGQIAKLKGCKVVGTAGSDEKVAWLK-KHGFDVALNYKTVKSLEEALKEAAPEGYDCY 214          
BLAST of FC931181 vs. ExPASy Swiss-Prot
Match: PTGR1_PIG (Prostaglandin reductase 1 OS=Sus scrofa GN=PTGR1 PE=1 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.753e-35
Identity = 92/227 (40.53%), Postives = 128/227 (56.39%), Query Frame = 1
Query:   43 VSNKQVILSNYVTGFPKESDMKIITGSINLKVPEGSKDTVLLKNLYLSCDPYMRGRMSKLDKPSFVASFNPGEPLSGYGVSKVLDSTHPNYKKDDLVWGLTSWEEYSLIQSP--QHLIKILDTNVPLSYYTGILGMPGLTAYGGLYELCSPKKGEYVYVSAASGAVGQLVGQFAKLVGCYVVGSAGSKEKVNLLKNKFGFDDAFNYKKEPDLDAALKRCFPEGIDIY 717
            V  K   L  +  G+P  S+ ++ T    +++P      VLL+ L+L+ DPYMR    KL +         G+ + G  V++V++S +  +    +V  L  W  +S+      + L+      +PLS   G +GMPGLTAY GL ++C  K GE V V+AA+GAVG +VGQ AKL GC VVG+AGS EKV  LK K+GFD AFNYK    L+  LK+  PEG D Y
Sbjct:    2 VRAKSWTLKKHFVGYPTPSNFELKT----VELPPLKNGEVLLEALFLTVDPYMRIAARKLKE---------GDMMMGEQVARVIESKNAAFPTGTIVVALLGWTTHSISDGKNLERLLAEWPDTLPLSLTLGTVGMPGLTAYFGLLDICGLKGGETVMVNAAAGAVGSVVGQIAKLKGCKVVGAAGSDEKVACLK-KYGFDVAFNYKTIESLEETLKKASPEGYDCY 214          
BLAST of FC931181 vs. ExPASy Swiss-Prot
Match: PTGR1_RAT (Prostaglandin reductase 1 OS=Rattus norvegicus GN=Ptgr1 PE=2 SV=3)

HSP 1 Score: 147.517 bits (371), Expect = 6.662e-35
Identity = 93/227 (40.97%), Postives = 127/227 (55.95%), Query Frame = 1
Query:   43 VSNKQVILSNYVTGFPKESDMKIITGSINLKVPEGSKDTVLLKNLYLSCDPYMRGRMSKLDKPSFVASFNPGEPLSGYGVSKVLDSTHPNYKKDDLVWGLTSWEEYSLIQSP--QHLIKILDTNVPLSYYTGILGMPGLTAYGGLYELCSPKKGEYVYVSAASGAVGQLVGQFAKLVGCYVVGSAGSKEKVNLLKNKFGFDDAFNYKKEPDLDAALKRCFPEGIDIY 717
            V  K   L  +  GFP +S+ ++ T     ++P  +   VLL+ L+LS DPYMR    KL +         G+ + G  V++V++S +  +    +V  L  W  +S+      + L       +PLS   G +GMPGLTAY GL ++C  K GE V V+AA+GAVG +VGQ AKL GC VVG+AGS EKV  LK K GFD AFNYK    L+ AL+   P+G D Y
Sbjct:    2 VQAKTWTLKKHFEGFPTDSNFELRT----TELPPLNNGEVLLEALFLSVDPYMRVAAKKLKE---------GDSMMGEQVARVVESKNSAFPTGTIVVALLGWTSHSISDGNGLRKLPAEWPDKLPLSLALGTVGMPGLTAYFGLLDICGLKGGETVLVNAAAGAVGSVVGQIAKLKGCKVVGTAGSDEKVAYLK-KLGFDVAFNYKTVKSLEEALRTASPDGYDCY 214          
The following BLAST results are available for this feature:
BLAST of FC931181 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
P2_ARATH8.013e-8969.91Probable NADP-dependent oxidoreductase P2 OS=Arabi... [more]
P1_ARATH2.850e-8668.42Probable NADP-dependent oxidoreductase P1 OS=Arabi... [more]
YFMJ_BACSU1.934e-4245.78Putative NADP-dependent oxidoreductase yfmJ OS=Bac... [more]
PTGR1_RABIT5.450e-3741.67Prostaglandin reductase 1 OS=Oryctolagus cuniculus... [more]
YNCB_ECOLI2.071e-3639.30Putative NADP-dependent oxidoreductase yncB OS=Esc... [more]
PTGR1_MOUSE7.870e-3642.11Prostaglandin reductase 1 OS=Mus musculus GN=Ptgr1... [more]
YKM8_SCHPO1.028e-3541.88Zinc-type alcohol dehydrogenase-like protein PB24D... [more]
PTGR1_BOVIN1.028e-3542.79Prostaglandin reductase 1 OS=Bos taurus GN=PTGR1 P... [more]
PTGR1_PIG1.753e-3540.53Prostaglandin reductase 1 OS=Sus scrofa GN=PTGR1 P... [more]
PTGR1_RAT6.662e-3540.97Prostaglandin reductase 1 OS=Rattus norvegicus GN=... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34102D01EF PostHarvP1 Citrus clementina cDNA clone C34102D01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931181 ID=FC931181|Name=FC931181|organism=Citrus clementina|type=EST|length=719bp
ATCAAAACAAAATCTACATACAAAATGGCGGGTGAAGAAGCAGTGAGCAA
CAAGCAGGTGATTCTGAGCAACTACGTGACAGGGTTTCCCAAGGAATCAG
ACATGAAGATAATAACAGGCTCAATAAACCTGAAGGTGCCAGAGGGCTCA
AAAGACACAGTGCTTTTGAAGAATCTTTATCTTTCCTGTGATCCTTACAT
GAGAGGACGTATGAGTAAGCTTGATAAGCCTTCGTTTGTTGCCTCCTTCA
ACCCTGGCGAGCCCTTGAGCGGATATGGAGTGTCCAAAGTGTTGGATTCC
ACACATCCAAATTATAAGAAAGATGACTTGGTCTGGGGCTTAACCAGTTG
GGAGGAGTACAGTCTCATCCAATCACCACAACATCTGATTAAAATTCTGG
ATACAAATGTGCCTCTGTCATACTATACTGGGATTCTTGGTATGCCTGGT
TTGACTGCATATGGTGGTTTATATGAGCTTTGCTCTCCTAAGAAAGGAGA
GTATGTCTATGTATCTGCAGCATCTGGAGCTGTTGGTCAGCTAGTTGGGC
AATTTGCAAAGTTGGTTGGTTGCTATGTTGTTGGAAGTGCAGGAAGCAAA
GAAAAGGTCAATCTGTTGAAGAACAAGTTTGGGTTTGATGATGCTTTTAA
CTATAAGAAAGAGCCAGACTTGGATGCAGCTCTTAAGAGGTGCTTTCCTG
AAGGCATCGACATCTATTT
back to top