FC931232

Overview
NameFC931232
Unique NameFC931232
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length702
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig11254 contig Ccv1_Contig11254:120..818. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931232 vs. ExPASy Swiss-Prot
Match: CH10C_ARATH (20 kDa chaperonin, chloroplastic OS=Arabidopsis thaliana GN=CPN21 PE=1 SV=2)

HSP 1 Score: 270.011 bits (689), Expect = 8.580e-72
Identity = 142/198 (71.72%), Postives = 158/198 (79.80%), Query Frame = 2
Query:  110 MATAQLTASSIKVPARSLTSFDGLRPSSVKFASVG-GAPSQRSFRRLXXXXXXXXXPKYTSIKPLGDRVLVKIKTVEEKTDGGIFLPSTAQTKPQAGEVVAVGEGKTVGKTKLDISVKPGTQVIYSKYAGTELEFNGANHLILREDDVVGILETDEIKDLKPLNDRVFIKVAEAEETTAGGLLLTEASKEKPFIGMVI 700
            MA  QLTAS + + ARSL S DGLR SSVKF+S+  G   Q  FRRL         PKYTSIKPLGDRVLVKIK  EEKT GGI LPSTAQ+KPQ GEVVAVGEG+T+GK K+DI+V  G Q+IYSKYAGTE+EFN   HLIL+EDD+VGILET++IKDLKPLNDRVFIKVAEAEE TAGGLLLTE +KEKP IG VI
Sbjct:    1 MAATQLTASPVTMSARSLASLDGLRASSVKFSSLKPGTLRQSQFRRLVVKAASVVAPKYTSIKPLGDRVLVKIKEAEEKTLGGILLPSTAQSKPQGGEVVAVGEGRTIGKNKIDITVPTGAQIIYSKYAGTEVEFNDVKHLILKEDDIVGILETEDIKDLKPLNDRVFIKVAEAEEKTAGGLLLTETTKEKPSIGTVI 198          

HSP 2 Score: 78.5666 bits (192), Expect = 3.664e-14
Identity = 41/93 (44.09%), Postives = 59/93 (63.44%), Query Frame = 2
Query:  290 IKPLGDRVLVKIKTVEEKTDGGIFLPSTAQTKPQAGEVVAVGEGKTVGKTKL-DISVKPGTQVIYSKYAGTELE-FNGANHLILREDDVVGIL 562
            +KPL DRV +K+   EEKT GG+ L  T + KP  G V+AVG G    + K+  + V  G+ V+YSKYAG + +  +G+N++ LR  DV+ IL
Sbjct:  160 LKPLNDRVFIKVAEAEEKTAGGLLLTETTKEKPSIGTVIAVGPGSLDEEGKITPLPVSTGSTVLYSKYAGNDFKGKDGSNYIALRASDVMAIL 252          
BLAST of FC931232 vs. ExPASy Swiss-Prot
Match: CH10C_SPIOL (20 kDa chaperonin, chloroplastic OS=Spinacia oleracea GN=CPN21 PE=2 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 5.053e-56
Identity = 112/201 (55.72%), Postives = 145/201 (72.14%), Query Frame = 2
Query:  110 MATAQLTASSIKVPARSLTSFDGLRPSS----VKFASVGGAPSQRSFRRLXXXXXXXXXPKYTSIKPLGDRVLVKIKTVEEKTDGGIFLPSTAQTKPQAGEVVAVGEGKTVGKTKLDISVKPGTQVIYSKYAGTELEFNGANHLILREDDVVGILETDEIKDLKPLNDRVFIKVAEAEETTAGGLLLTEASKEKPFIGMVI 700
            MA   LT++S  +   +L SF+GLR +S    +  +    + + RSFR L          KYTS+KPLGDRVL+K K VEEKT  GIFLP+ AQ KPQ+GEVVA+G GK VG  KL ++VK G +V+YSKY GTE+E +G++HLI++EDD++GILETD++KDLKPLNDR+ IKVAE E  T+GGLLL E+SKEKP  G V+
Sbjct:    1 MAATHLTSTS-SLTINTLPSFEGLRSASGISKINVSVAYPSFTSRSFRGLVVRAASITTSKYTSVKPLGDRVLIKTKIVEEKTTSGIFLPTAAQKKPQSGEVVAIGSGKKVGDKKLPVAVKTGAEVVYSKYTGTEIEVDGSSHLIVKEDDIIGILETDDVKDLKPLNDRLLIKVAEVENKTSGGLLLAESSKEKPSFGTVV 200          

HSP 2 Score: 73.559 bits (179), Expect = 1.179e-12
Identity = 37/93 (39.78%), Postives = 60/93 (64.52%), Query Frame = 2
Query:  290 IKPLGDRVLVKIKTVEEKTDGGIFLPSTAQTKPQAGEVVAVGEGKTVGK-TKLDISVKPGTQVIYSKYAGTELE-FNGANHLILREDDVVGIL 562
            +KPL DR+L+K+  VE KT GG+ L  +++ KP  G VVA G G    +  ++ + V  G  V+YSKYAG + +  +G+++++LR  DV+ +L
Sbjct:  162 LKPLNDRLLIKVAEVENKTSGGLLLAESSKEKPSFGTVVATGPGVLDEEGNRIPLPVCSGNTVLYSKYAGNDFKGVDGSDYMVLRVSDVMAVL 254          
BLAST of FC931232 vs. ExPASy Swiss-Prot
Match: CH10_RHOMR (10 kDa chaperonin OS=Rhodothermus marinus GN=groS PE=3 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 3.306e-23
Identity = 48/95 (50.53%), Postives = 72/95 (75.79%), Query Frame = 2
Query:  290 IKPLGDRVLVKIKTVEEKTDGGIFLPSTAQTKPQAGEVVAVGEGKTVGKTKLDISVKPGTQVIYSKYAGTELEFNGANHLILREDDVVGILETDE 574
            IKPL DRV++K +  EEKT+ G+++P TA+ KPQ G V+AVG G+    TK+++SVK G +V+Y KYAGTE+  +G  +LI+RE D++GI+E ++
Sbjct:    6 IKPLSDRVVIKPEPPEEKTESGLYIPDTAKEKPQRGTVIAVGPGRVENGTKIEMSVKEGDKVLYGKYAGTEITIDGEEYLIMRETDILGIIEEEK 100          
BLAST of FC931232 vs. ExPASy Swiss-Prot
Match: CH10_THEPX (10 kDa chaperonin OS=Thermoanaerobacter sp. (strain X514) GN=groS PE=3 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 5.639e-23
Identity = 50/92 (54.35%), Postives = 70/92 (76.09%), Query Frame = 2
Query:  290 IKPLGDRVLVKIKTVEEKTDGGIFLPSTAQTKPQAGEVVAVGEGKTVGKTKLDISVKPGTQVIYSKYAGTELEFNGANHLILREDDVVGILE 565
            +KPLGDRV+VK+   EE T GG+ LP TA+ KPQ GEVVAVG G+ +   K+++ VK G +VI+SKYAGTE++ +G  +L+LRE D++ I+E
Sbjct:    3 LKPLGDRVVVKVIQAEEVTKGGVILPGTAKEKPQQGEVVAVGTGQYIDGKKVELEVKVGDRVIFSKYAGTEVKLDGEEYLLLRESDILAIIE 94          
BLAST of FC931232 vs. ExPASy Swiss-Prot
Match: CH10_THEP3 (10 kDa chaperonin OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=groS PE=3 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 5.639e-23
Identity = 50/92 (54.35%), Postives = 70/92 (76.09%), Query Frame = 2
Query:  290 IKPLGDRVLVKIKTVEEKTDGGIFLPSTAQTKPQAGEVVAVGEGKTVGKTKLDISVKPGTQVIYSKYAGTELEFNGANHLILREDDVVGILE 565
            +KPLGDRV+VK+   EE T GG+ LP TA+ KPQ GEVVAVG G+ +   K+++ VK G +VI+SKYAGTE++ +G  +L+LRE D++ I+E
Sbjct:    3 LKPLGDRVVVKVIQAEEVTKGGVILPGTAKEKPQQGEVVAVGTGQYIDGKKVELEVKVGDRVIFSKYAGTEVKLDGEEYLLLRESDILAIIE 94          
BLAST of FC931232 vs. ExPASy Swiss-Prot
Match: CH10_THEBR (10 kDa chaperonin OS=Thermoanaerobacter brockii GN=groS PE=1 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 5.639e-23
Identity = 50/92 (54.35%), Postives = 70/92 (76.09%), Query Frame = 2
Query:  290 IKPLGDRVLVKIKTVEEKTDGGIFLPSTAQTKPQAGEVVAVGEGKTVGKTKLDISVKPGTQVIYSKYAGTELEFNGANHLILREDDVVGILE 565
            +KPLGDRV+VK+   EE T GG+ LP TA+ KPQ GEVVAVG G+ +   K+++ VK G +VI+SKYAGTE++ +G  +L+LRE D++ I+E
Sbjct:    3 LKPLGDRVVVKVIQAEEVTKGGVILPGTAKEKPQQGEVVAVGTGEYIDGKKVELEVKVGDRVIFSKYAGTEVKLDGEEYLLLRESDILAIIE 94          
BLAST of FC931232 vs. ExPASy Swiss-Prot
Match: CH10_NATTJ (10 kDa chaperonin OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=groS PE=3 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.143e-22
Identity = 49/94 (52.13%), Postives = 72/94 (76.60%), Query Frame = 2
Query:  287 SIKPLGDRVLVKIKTVEEKTDGGIFLPSTAQTKPQAGEVVAVGEGKTVGK-TKLDISVKPGTQVIYSKYAGTELEFNGANHLILREDDVVGILE 565
            ++KPLGDR+++KI   EEKT+ GI LP  A+ KPQ GEVVAVG GKT+   +K++  VK G +V+YSK+AG E+E +G  +LI+R+DD++ ++E
Sbjct:    2 NLKPLGDRIVIKILEAEEKTESGIVLPEKAKEKPQEGEVVAVGSGKTLDDGSKVEPEVKAGDKVVYSKFAGNEVEVDGEEYLIMRQDDILAVIE 95          
BLAST of FC931232 vs. ExPASy Swiss-Prot
Match: CH10_DESVV (10 kDa chaperonin OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=groS PE=3 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 6.235e-22
Identity = 50/94 (53.19%), Postives = 69/94 (73.40%), Query Frame = 2
Query:  287 SIKPLGDRVLVKIKTVEEKTDGGIFLPSTAQTKPQAGEVVAVGEGKTVGKTKL-DISVKPGTQVIYSKYAGTELEFNGANHLILREDDVVGILE 565
            ++KPL DRVLVK    EEKT GG+++P TA+ KP  GEVVA G GKT    KL  ++VK G  V+++KYAGTE++ +G  HL++REDD++ I+E
Sbjct:    2 NLKPLNDRVLVKRLESEEKTAGGLYIPDTAKEKPSRGEVVAAGPGKTADDGKLVAMTVKAGDMVLFNKYAGTEIKIDGVEHLVMREDDILAIIE 95          
BLAST of FC931232 vs. ExPASy Swiss-Prot
Match: CH10_DESVH (10 kDa chaperonin OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=groS PE=3 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 6.235e-22
Identity = 50/94 (53.19%), Postives = 69/94 (73.40%), Query Frame = 2
Query:  287 SIKPLGDRVLVKIKTVEEKTDGGIFLPSTAQTKPQAGEVVAVGEGKTVGKTKL-DISVKPGTQVIYSKYAGTELEFNGANHLILREDDVVGILE 565
            ++KPL DRVLVK    EEKT GG+++P TA+ KP  GEVVA G GKT    KL  ++VK G  V+++KYAGTE++ +G  HL++REDD++ I+E
Sbjct:    2 NLKPLNDRVLVKRLESEEKTAGGLYIPDTAKEKPSRGEVVAAGPGKTADDGKLVAMTVKAGDMVLFNKYAGTEIKIDGVEHLVMREDDILAIIE 95          
BLAST of FC931232 vs. ExPASy Swiss-Prot
Match: CH10_DESHY (10 kDa chaperonin OS=Desulfitobacterium hafniense (strain Y51) GN=groS PE=3 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 6.235e-22
Identity = 49/92 (53.26%), Postives = 69/92 (75.00%), Query Frame = 2
Query:  287 SIKPLGDRVLVKIKTVEEKTDGGIFLPSTAQTKPQAGEVVAVGEGKTVGKTKLDISVKPGTQVIYSKYAGTELEFNGANHLILREDDVVGIL 562
            +IKPLGDRV++K   +EEKT  GI +P TA+ KPQ GEVVAVG GK     ++ + VK G +VIYSKYAGTE++++G  +LIL+E D++ ++
Sbjct:    2 NIKPLGDRVVIKALPMEEKTKSGIIMPDTAKEKPQEGEVVAVGPGKMEKGERIVLDVKVGDRVIYSKYAGTEVKYDGQEYLILKETDILAVI 93          
The following BLAST results are available for this feature:
BLAST of FC931232 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 492
Match NameE-valueIdentityDescription
CH10C_ARATH8.580e-7271.7220 kDa chaperonin, chloroplastic OS=Arabidopsis th... [more]
CH10C_SPIOL5.053e-5655.7220 kDa chaperonin, chloroplastic OS=Spinacia olera... [more]
CH10_RHOMR3.306e-2350.5310 kDa chaperonin OS=Rhodothermus marinus GN=groS ... [more]
CH10_THEPX5.639e-2354.3510 kDa chaperonin OS=Thermoanaerobacter sp. (strai... [more]
CH10_THEP35.639e-2354.3510 kDa chaperonin OS=Thermoanaerobacter pseudethan... [more]
CH10_THEBR5.639e-2354.3510 kDa chaperonin OS=Thermoanaerobacter brockii GN... [more]
CH10_NATTJ2.143e-2252.1310 kDa chaperonin OS=Natranaerobius thermophilus (... [more]
CH10_DESVV6.235e-2253.1910 kDa chaperonin OS=Desulfovibrio vulgaris subsp.... [more]
CH10_DESVH6.235e-2253.1910 kDa chaperonin OS=Desulfovibrio vulgaris (strai... [more]
CH10_DESHY6.235e-2253.2610 kDa chaperonin OS=Desulfitobacterium hafniense ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34102H11EF PostHarvP1 Citrus clementina cDNA clone C34102H11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931232 ID=FC931232|Name=FC931232|organism=Citrus clementina|type=EST|length=702bp
GCTCGACTCTTCTTCAATTTCAACTAGAAACCTTATCAAACTACTCGCTC
GCTTCTCGCTTATCATTTCCAATCAGAATCTCTCTCGCTCTCTCTGCATC
TGCAAGCAGATGGCGACAGCTCAGCTAACAGCGTCATCAATTAAGGTTCC
AGCAAGGAGCTTGACTTCATTCGATGGTCTCAGACCGTCTTCCGTCAAGT
TCGCTTCCGTCGGAGGTGCTCCCAGCCAACGCTCTTTCCGTCGCTTGGTC
GTTAAAGCCGCTGCAGTCGTGGCTCCCAAGTACACTTCAATTAAACCTTT
GGGTGATAGAGTGCTGGTGAAAATCAAGACTGTAGAGGAGAAAACTGATG
GTGGTATTTTTCTGCCATCTACAGCTCAAACAAAGCCTCAAGCAGGTGAG
GTGGTAGCTGTTGGCGAGGGGAAGACAGTTGGGAAGACTAAACTGGACAT
ATCTGTGAAGCCTGGGACCCAGGTCATCTATTCGAAGTATGCAGGGACTG
AGTTGGAGTTCAATGGCGCAAATCATCTCATATTGAGGGAGGATGACGTA
GTTGGCATTCTTGAAACAGATGAAATCAAGGATCTTAAGCCCCTTAATGA
CAGAGTTTTCATCAAGGTTGCTGAGGCTGAAGAGACAACTGCTGGAGGTT
TGTTGTTGACGGAGGCAAGCAAGGAGAAACCCTTCATTGGAATGGTCATT
GC
back to top