FC931238

Overview
NameFC931238
Unique NameFC931238
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length736
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15517 contig Ccv1_Contig15517:17..752. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931238 vs. ExPASy Swiss-Prot
Match: SYP51_ARATH (Syntaxin-51 OS=Arabidopsis thaliana GN=SYP51 PE=1 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 3.174e-80
Identity = 150/195 (76.92%), Postives = 176/195 (90.26%), Query Frame = 3
Query:  147 MASASDSWIKEYNEAIKLADDINGMISERSSMPASGPESQRHASAIRRKITILGTRLDSLQSLLSKLPGKQPISEKEMNRRKDMLANLRSKVNQMASTLNMSNFANRDSLLGPEIKSADVMNRATGLDNQGLVGFQRQIMREQDEGLEKLEETVVSTKHIALAVNEELDLHTRLIDDLDQHVDVTDSRLRRVQKN 731
            MAS+SDSW++ YNEA+KL+++INGMISERSS   +GP++QR ASAIRRKITI G +LDSLQSLL+++ GK PISEKEMNRRKDM+ NLRSK NQMA+ LNMSNFANRDSLLGP+IK  D M+R TG+DNQG+VG+QRQ+MREQDEGLE+LE TV+STKHIALAV+EELDL TRLIDDLD HVDVTDSRLRRVQK+
Sbjct:    1 MASSSDSWMRAYNEALKLSEEINGMISERSSSAVTGPDAQRRASAIRRKITIFGNKLDSLQSLLAEIHGK-PISEKEMNRRKDMVGNLRSKANQMANALNMSNFANRDSLLGPDIKPDDSMSRVTGMDNQGIVGYQRQVMREQDEGLEQLEGTVMSTKHIALAVSEELDLQTRLIDDLDYHVDVTDSRLRRVQKS 194          
BLAST of FC931238 vs. ExPASy Swiss-Prot
Match: SYP52_ARATH (Syntaxin-52 OS=Arabidopsis thaliana GN=SYP52 PE=1 SV=1)

HSP 1 Score: 297.745 bits (761), Expect = 4.145e-80
Identity = 148/195 (75.90%), Postives = 174/195 (89.23%), Query Frame = 3
Query:  147 MASASDSWIKEYNEAIKLADDINGMISERSSMPASGPESQRHASAIRRKITILGTRLDSLQSLLSKLPGKQPISEKEMNRRKDMLANLRSKVNQMASTLNMSNFANRDSLLGPEIKSADVMNRATGLDNQGLVGFQRQIMREQDEGLEKLEETVVSTKHIALAVNEELDLHTRLIDDLDQHVDVTDSRLRRVQKN 731
            MAS+SD W++EYNEA+KL++DINGM+SER++   +GP++QR ASAIRRKITILGTRLDSLQSLL K+PGKQ +SEKEMNRRKDM+ NLRSK NQ+AS LNMSNFANRDSL G ++K  D +NR +G+DNQG+V FQRQ+MREQDEGLEKLEETV+STKHIALAVNEEL L TRLIDDLD  VD+TDSRLRRVQK+
Sbjct:    1 MASSSDPWMREYNEALKLSEDINGMMSERNASGLTGPDAQRRASAIRRKITILGTRLDSLQSLLVKVPGKQHVSEKEMNRRKDMVGNLRSKTNQVASALNMSNFANRDSLFGTDLKPDDAINRVSGMDNQGIVVFQRQVMREQDEGLEKLEETVMSTKHIALAVNEELTLQTRLIDDLDYDVDITDSRLRRVQKS 195          
BLAST of FC931238 vs. ExPASy Swiss-Prot
Match: STX8B_DICDI (Probable syntaxin-8B OS=Dictyostelium discoideum GN=syn8B PE=3 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 7.203e-16
Identity = 62/204 (30.39%), Postives = 104/204 (50.98%), Query Frame = 3
Query:  162 DSWIKEYNEAIKLADDINGMISERSSMPASGPES-QRHASA-IRRKITILGTRLDSLQSLLSKLPGKQPISEKEMNRRKDMLANLRSKVNQMASTLN--MSNFANRDSLLGPEIK-SADVMNRATG----------LDNQGLVGFQRQIMREQDEGLEKLEETVVSTKHIALAVNEELDLHTRLIDDLDQHVDVTDSRLRRVQK 728
            D W+ E++  +KL + +   I E S    + P   Q++  A +R  +  +   +  LQ  L+     + I EKE+ RRK+ + +L S  NQ+ STL+  ++N + ++ L+G          NR  G           DNQ L   Q+ IMREQDE L+ L ++++  K++A A++ ELD H  ++DD++   D    RLR   +
Sbjct:    3 DYWLNEHDNIVKLINSLTADIKEYSIQQRNNPGIVQKNTPAKLRNGLVHITNEILRLQDSLT-YGNNRNIQEKELLRRKNKVESLISMKNQLNSTLDAAINNTSQKNELMGNNNGVGIGYSNRQFGKPKETEATKQFDNQQLFTNQQHIMREQDESLDLLSQSIMRQKNMAHAMSNELDQHNEMLDDVEIGTDAVSMRLRNANR 205          
BLAST of FC931238 vs. ExPASy Swiss-Prot
Match: STX8_RAT (Syntaxin-8 OS=Rattus norvegicus GN=Stx8 PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.271e-12
Identity = 54/202 (26.73%), Postives = 94/202 (46.53%), Query Frame = 3
Query:  156 ASDSWIKEYNEAIKLADDINGMISERSSMPASGPESQRHASAIRRKITILGTRLDSLQSLLSKLPGKQPISEKEMNRRKDMLANLRSKVNQMASTLNMSNFAN--------RDSLLGPEIKSA-------DVMNRATGLDNQGLVGFQRQIMREQDEGLEKLEETVVSTKHIALAVNEELDLHTRLIDDLDQHVDVTDSRLR 716
            A D W   Y+   ++A +I   I ER+     G ++ +    IR  +  L  ++D L+ LL +    + I++ E +RR+++L +L ++       L +++F N        R SL+  E K         +      GL    +   Q++I++EQD GL+ L   +   K +   +  ELD    +IDDL   V+ TD +LR
Sbjct:    2 APDPWFSTYDSTCQIAQEIAEKIQERNQCERRGEKTPKLTLTIRTLLKNLKVKIDLLKDLLLRAVSTRQITQLEGDRRQNLLDDLVTR-----ERLLLASFKNEGSEPDLIRSSLMSEEAKRGTPNPWLCEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLR 198          
BLAST of FC931238 vs. ExPASy Swiss-Prot
Match: STX8_MOUSE (Syntaxin-8 OS=Mus musculus GN=Stx8 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.271e-12
Identity = 54/202 (26.73%), Postives = 94/202 (46.53%), Query Frame = 3
Query:  156 ASDSWIKEYNEAIKLADDINGMISERSSMPASGPESQRHASAIRRKITILGTRLDSLQSLLSKLPGKQPISEKEMNRRKDMLANLRSKVNQMASTLNMSNFAN--------RDSLLGPEIKSA-------DVMNRATGLDNQGLVGFQRQIMREQDEGLEKLEETVVSTKHIALAVNEELDLHTRLIDDLDQHVDVTDSRLR 716
            A D W   Y+   ++A +I   I ER+     G ++ +    IR  +  L  ++D L+ LL +    + I++ E +RR+++L +L ++       L +++F N        R SL+  E K         +      GL    +   Q++I++EQD GL+ L   +   K +   +  ELD    +IDDL   V+ TD +LR
Sbjct:    2 APDPWFSTYDSTCQIAQEIAEKIQERNQCERRGEKTPKLTLTIRTLLKNLKVKIDLLKDLLLRAVSTRQITQLEGDRRQNLLDDLVTR-----ERLLLASFKNEGAEPDLIRSSLMSEEAKRGTPNPWLCEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLR 198          
BLAST of FC931238 vs. ExPASy Swiss-Prot
Match: STX8_HUMAN (Syntaxin-8 OS=Homo sapiens GN=STX8 PE=1 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 3.132e-11
Identity = 52/202 (25.74%), Postives = 92/202 (45.54%), Query Frame = 3
Query:  156 ASDSWIKEYNEAIKLADDINGMISERSSMPASGPESQRHASAIRRKITILGTRLDSLQSLLSKLPGKQPISEKEMNRRKDMLANLRSKVNQMASTLNMSNFAN--------RDSLLGPEIKSA-------DVMNRATGLDNQGLVGFQRQIMREQDEGLEKLEETVVSTKHIALAVNEELDLHTRLIDDLDQHVDVTDSRLR 716
            A D W   Y+   ++A +I   I +R+     G ++ +    IR  +  L  ++  L+ LL +      I++ E +RR+++L +L ++       L +++F N        R SL+  E K         +      GL    +   Q++I++EQD GL+ L   +   K +   +  ELD    +IDDL   V+ TD +LR
Sbjct:    2 APDPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQITQLEGDRRQNLLDDLVTR-----ERLLLASFKNEGAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLR 198          
The following BLAST results are available for this feature:
BLAST of FC931238 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
SYP51_ARATH3.174e-8076.92Syntaxin-51 OS=Arabidopsis thaliana GN=SYP51 PE=1 ... [more]
SYP52_ARATH4.145e-8075.90Syntaxin-52 OS=Arabidopsis thaliana GN=SYP52 PE=1 ... [more]
STX8B_DICDI7.203e-1630.39Probable syntaxin-8B OS=Dictyostelium discoideum G... [more]
STX8_RAT1.271e-1226.73Syntaxin-8 OS=Rattus norvegicus GN=Stx8 PE=1 SV=1[more]
STX8_MOUSE1.271e-1226.73Syntaxin-8 OS=Mus musculus GN=Stx8 PE=2 SV=1[more]
STX8_HUMAN3.132e-1125.74Syntaxin-8 OS=Homo sapiens GN=STX8 PE=1 SV=2[more]
back to top
Properties
Property NameValue
Genbank descriptionC34103A05EF PostHarvP1 Citrus clementina cDNA clone C34103A05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931238 ID=FC931238|Name=FC931238|organism=Citrus clementina|type=EST|length=736bp
GAGGACGGGCCGTACAAAACCGGCAGTGTTGACGCTAATTCCCGTCTTTT
AGCTCGTTAATGCGACTTAGCTTTGCTCCATCCTAAACTTCTCCAATCCA
ATCCCTCTCTCAGTCTAGAATCCGAAATCTACCCATAATCTGTTCAATGG
CTTCTGCTTCAGACTCGTGGATAAAGGAATACAATGAAGCAATAAAACTG
GCAGATGATATTAATGGCATGATATCAGAACGAAGTTCGATGCCCGCATC
TGGACCTGAATCCCAGCGTCATGCATCTGCCATACGGAGGAAGATTACCA
TATTAGGAACCAGATTGGATAGCTTGCAGTCCCTTTTATCTAAGCTTCCC
GGGAAGCAGCCCATTTCGGAGAAAGAGATGAATCGTCGGAAGGACATGCT
TGCTAATTTGAGATCCAAAGTGAATCAAATGGCTTCCACGTTGAACATGT
CAAACTTTGCTAATAGGGATAGCCTGCTTGGACCAGAGATAAAGTCAGCC
GATGTCATGAACCGAGCAACTGGCTTGGACAATCAGGGCCTTGTTGGTTT
TCAACGACAAATTATGAGAGAGCAAGATGAAGGGCTTGAGAAACTGGAGG
AGACAGTAGTCAGTACAAAGCATATTGCATTGGCAGTCAATGAAGAACTT
GACCTGCACACTAGACTTATTGATGACTTGGACCAGCATGTGGATGTTAC
AGATTCTCGCCTACGGCGAGTGCAGAAGAACCCTGG
back to top