FC931241

Overview
NameFC931241
Unique NameFC931241
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length786
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC931241_ssr30 microsatellite FC931241_ssr30:30..44. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of FC931241 vs. ExPASy Swiss-Prot
Match: U4977_ARATH (UPF0497 membrane protein At2g28370 OS=Arabidopsis thaliana GN=At2g28370 PE=2 SV=1)

HSP 1 Score: 274.248 bits (700), Expect = 5.489e-73
Identity = 136/175 (77.71%), Postives = 152/175 (86.86%), Query Frame = 3
Query:  237 MNVSHASVHPVEDPPT--TEGGNAPRVRMKDIQGMPATPGGLALRVSQFIFAVAALCVMATTSDFPSVTAFCFLVAAAGLQSLWSLSLAIVDIYALSVMRSLQNSRIVNLFTVGDGITSTLTFAAACASAGITVLIDNDLQSCSQNHCIQFETXTAMAFISWFTALPSFLVNFGS 755
            MNVSHASVHPVEDPP   TE  N PRVRM D++GMP T  GLALR  QF+FA AALCVMA+TSDFPSVTAFC+LVAA GLQSLWSL+LA+VD+YA+ V RSLQN R+V+LF +GDG+TSTLTFAAACASAGITVLIDNDL SC+QNHC+QFET TA+AFISWF ALPSFL NF S
Sbjct:    1 MNVSHASVHPVEDPPAAATEVENPPRVRMDDMEGMPGTLLGLALRFFQFLFAAAALCVMASTSDFPSVTAFCYLVAATGLQSLWSLALAMVDVYAIMVKRSLQNRRLVSLFAIGDGVTSTLTFAAACASAGITVLIDNDLNSCAQNHCVQFETSTALAFISWFAALPSFLFNFWS 175          
BLAST of FC931241 vs. ExPASy Swiss-Prot
Match: U497B_ARATH (UPF0497 membrane protein At2g37200 OS=Arabidopsis thaliana GN=At2g37200 PE=2 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 8.804e-55
Identity = 112/176 (63.64%), Postives = 130/176 (73.86%), Query Frame = 3
Query:  237 MNVSHASVHPVEDPPTTEGGNA---PRVRMKDIQGMPATPGGLALRVSQFIFAVAALCVMATTSDFPSVTAFCFLVAAAGLQSLWSLSLAIVDIYALSVMRSLQNSRIVNLFTVGDGITSTLTFAAACASAGITVLIDNDLQSCSQNHCIQFETXTAMAFISWFTALPSFLVNFGS 755
            MNVS  ++HPV+  P      A   P VRMKD+QGMP T GGL LR+SQF+ A+ ++ VM TTSDF S TAFC LV A  LQSLWSLSL I+D YAL V RSL+N  +V  FT+GDG+TSTLTFAAA ASAGITVLI NDL  C+ NHC +FET TAMAFISWF   PSF++NF S
Sbjct:    2 MNVSRPAIHPVDALPVAPTAGAIDRPPVRMKDVQGMPGTTGGLILRLSQFVPALISVSVMVTTSDFRSATAFCCLVLAVSLQSLWSLSLFIIDAYALLVRRSLRNHSVVQCFTIGDGVTSTLTFAAASASAGITVLI-NDLGQCNVNHCTRFETATAMAFISWFAVSPSFILNFWS 176          
BLAST of FC931241 vs. ExPASy Swiss-Prot
Match: U497J_ARATH (UPF0497 membrane protein At3g23200 OS=Arabidopsis thaliana GN=At3g23200 PE=2 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 2.852e-29
Identity = 69/143 (48.25%), Postives = 93/143 (65.03%), Query Frame = 3
Query:  315 MKDIQGMPATPGGLALRVSQFIFAVAALCVMATTSDFPSVTAFCFLVAAAGLQSLWSLSLAIVDIYALSVMRSLQNSRIVNLFTVGDGITSTLTFAAACASAGITVLIDNDLQSCS-QNHCIQFETXTAMAFISWFTALPSFL 740
            M DI G P T  GL LR+SQ +FA  ++  M T+  F S TAFC+L+AA GLQ +WS  LAI+D +AL   ++L +  +V+LF VGD +TSTL+ A A +SAGITVL   DL SCS +  C +++   A+AF+ W T   S L
Sbjct:    1 MIDIPGTPGTLTGLVLRISQCVFAAGSISYMVTSGGFFSFTAFCYLIAAMGLQVIWSFGLAILDTFALVRKKTLLSPVLVSLFVVGDWVTSTLSLAGASSSAGITVLYFGDLGSCSFEAECWKYQLSVALAFLCWITIAVSSL 143          
BLAST of FC931241 vs. ExPASy Swiss-Prot
Match: U497L_ARATH (UPF0497 membrane protein At3g53850 OS=Arabidopsis thaliana GN=At3g53850 PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 6.353e-29
Identity = 65/148 (43.92%), Postives = 94/148 (63.51%), Query Frame = 3
Query:  315 MKDIQGMPATPGGLALRVSQFIFAVAALCVMATTSDFPSVTAFCFLVAAAGLQSLWSLSLAIVDIYALSVMRSLQNSRIVNLFTVGDGITSTLTFAAACASAGITVLIDNDLQSC---SQNHCIQFETXTAMAFISWFTALPSFLVNF 749
            MK + G P T  GL LR+ Q   A A++ VM +  +F   TAFC+L+A+ GLQ LWS  LA +D+YAL   + LQN  +V+LF VGD +T+ L+ AAAC+SAG+ VL + D++ C   SQ  C+++E   A++F++W     S  V F
Sbjct:    1 MKKLLGGPGTVCGLLLRIGQCASAAASIGVMVSAKEFSVHTAFCYLIASMGLQLLWSFGLACLDVYALRGKKDLQNPILVSLFVVGDWVTAMLSLAAACSSAGVVVLYEKDIKYCNTQSQYPCLRYEVAVALSFVTWIQIAVSSHVTF 148          
BLAST of FC931241 vs. ExPASy Swiss-Prot
Match: U497X_ARATH (UPF0497 membrane protein At5g02060 OS=Arabidopsis thaliana GN=At5g02060 PE=2 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 1.198e-27
Identity = 62/140 (44.29%), Postives = 89/140 (63.57%), Query Frame = 3
Query:  315 MKDIQGMPATPGGLALRVSQFIFAVAALCVMATTSDFPSVTAFCFLVAAAGLQSLWSLSLAIVDIYALSVMRSLQNSRIVNLFTVGDGITSTLTFAAACASAGITVLIDNDLQSCSQN---HCIQFETXTAMAFISWFTA 725
            MK + G P T  GL LR+ Q   A A++ VM ++ DF + TAFCFLVA+ GLQ +WS  LA +D+YA+     L++  +++LFTVGD +T+ L  AAAC+SAG+TVL   D + C Q     C +F+    ++F +WF A
Sbjct:    1 MKKMIGSPGTMSGLILRLGQCATAAASIGVMVSSYDFSNYTAFCFLVASMGLQLIWSFGLACLDVYAIRRKSDLRSPILLSLFTVGDWVTALLALAAACSSAGVTVLFTKDTEFCRQQPALSCDRFQISVGLSFFNWFLA 140          
BLAST of FC931241 vs. ExPASy Swiss-Prot
Match: U497K_ARATH (UPF0497 membrane protein At3g50810 OS=Arabidopsis thaliana GN=At3g50810 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 4.564e-19
Identity = 53/148 (35.81%), Postives = 78/148 (52.70%), Query Frame = 3
Query:  315 MKDIQGMPATPGGLALRVSQFIFAVAALCVMATTSDFPSVTAFCFLVAAAGLQSLWSLSLAIVDIYALSVMRSLQNSRIVNLFTVGDGITSTLTFAAACASAGITVLIDN-DLQSCSQNHCIQFETXTAMAFISWFTALPSFLVNFGS 755
            M+ + G   T    ALR  Q IF+ A+L  M    DF   T FC+L     + + WS+ LA+ D Y++ V    Q  R++++   GD + S L+   ACA A  T L+ + D + C  + CIQ++   A+AF+ WF  L S L NF S
Sbjct:    1 MEHVPGSFGTSASFALRFGQTIFSAASLIFMCFDFDFYDFTTFCYLAMVMAIVTPWSILLALTDTYSVLVKLLPQELRVLSIVFAGDFVLSFLSLGGACAVASATELLASADGKICDGSLCIQYQVSAALAFLCWFLLLASALFNFWS 148          
BLAST of FC931241 vs. ExPASy Swiss-Prot
Match: U4974_ARATH (Putative UPF0497 membrane protein At1g49405 OS=Arabidopsis thaliana GN=At1g49405 PE=3 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 5.960e-19
Identity = 47/144 (32.64%), Postives = 79/144 (54.86%), Query Frame = 3
Query:  315 MKDIQGMPATPGGLALRVSQFIFAVAALCVMATTSDFPSVTAFCFLVAAAGLQSLWSLSLAIVDIYALSVMRSLQNSRIVNLFTVGDGITSTLTFAAACASAGITVLIDNDLQSCSQNHCIQFETXTAMAFISWFTALPSFLVN 746
            M ++ G   T   L+LR+ Q + A  +L  M     F   TAFC+LV    L   W+L+LA+VDIY + + +  Q  RI+   ++GD + S L  A+A ++A +  ++ ++  SC    C +++    +AF++WF +L S L N
Sbjct:    1 MVEVPGSVGTTASLSLRLGQMVLAFGSLLFMTIGVRFYQFTAFCYLVTIMSLAIPWNLTLAMVDIYCVILQQPFQKPRILLAISIGDWVVSVLALASASSAASVVDILRSNESSCPPTICNRYQFAATLAFLTWFLSLSSSLFN 144          
BLAST of FC931241 vs. ExPASy Swiss-Prot
Match: U497W_ARATH (UPF0497 membrane protein At4g37235 OS=Arabidopsis thaliana GN=At4g37235 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.984e-14
Identity = 42/138 (30.43%), Postives = 73/138 (52.90%), Query Frame = 3
Query:  342 TPGGLALRVSQFIFAVAALCVMATTSD--FPSVTAFCFLVAAAGLQSLWSLSLAIVDIYALSVMRSLQNSRIVNLFTVGDGITSTLTFAAACASAGITVLIDNDLQSCSQNHCIQFETXTAMAFISWFTALPSFLVNF 749
            T     LR+ Q +F+ A+L  M    D  F + T FC+LV   GL + WS++LA+++ Y++ V +    + ++++   GD + S L+   AC++A + VL    L    +  C +++    MAF+S F +  S   NF
Sbjct:   10 TSSSFVLRLGQTLFSSASLLFMCFNDDEDFYAYTTFCYLVTVMGLVTPWSVTLALMEAYSILVKKLPMQATVISVIVAGDFVLSFLSLGGACSTASVAVL----LMDAGEKQCDRYKLSATMAFLSSFLSFASTFFNF 143          
The following BLAST results are available for this feature:
BLAST of FC931241 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
U4977_ARATH5.489e-7377.71UPF0497 membrane protein At2g28370 OS=Arabidopsis ... [more]
U497B_ARATH8.804e-5563.64UPF0497 membrane protein At2g37200 OS=Arabidopsis ... [more]
U497J_ARATH2.852e-2948.25UPF0497 membrane protein At3g23200 OS=Arabidopsis ... [more]
U497L_ARATH6.353e-2943.92UPF0497 membrane protein At3g53850 OS=Arabidopsis ... [more]
U497X_ARATH1.198e-2744.29UPF0497 membrane protein At5g02060 OS=Arabidopsis ... [more]
U497K_ARATH4.564e-1935.81UPF0497 membrane protein At3g50810 OS=Arabidopsis ... [more]
U4974_ARATH5.960e-1932.64Putative UPF0497 membrane protein At1g49405 OS=Ara... [more]
U497W_ARATH1.984e-1430.43UPF0497 membrane protein At4g37235 OS=Arabidopsis ... [more]
back to top
Properties
Property NameValue
Genbank descriptionC34103A08EF PostHarvP1 Citrus clementina cDNA clone C34103A08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931241 ID=FC931241|Name=FC931241|organism=Citrus clementina|type=EST|length=786bp
GACTGGTGAGGTTTGTAAAGACCTTTCGCCTTTGCTTTGCTTTGCTCGTA
AACAAACATAAGCTCAATCACAGTTTCTAACGGCAATTACGCTTCGCTGT
TAAACTATTTTGCCAGGTTCTTCATAATTAAGTGGTAACACGCTGGTGCT
TTTAATTCGGTACATAAGTGATAGTAGCTTACGGAGAGAAATTGAGGGAT
AGAGAGCTATGAATTGAAGCTTGTGATCGTCAAGAGATGAACGTGAGCCA
CGCGTCGGTTCACCCGGTTGAAGATCCTCCAACTACAGAAGGTGGGAATG
CCCCGAGAGTGAGGATGAAGGACATACAGGGCATGCCGGCGACGCCTGGT
GGGCTGGCTTTGCGTGTATCTCAATTTATCTTTGCTGTTGCAGCACTTTG
TGTGATGGCCACCACTAGCGACTTTCCTTCGGTCACTGCTTTCTGCTTCC
TTGTTGCGGCTGCTGGCTTGCAGAGTTTGTGGAGCCTTTCACTGGCAATT
GTAGATATTTATGCCCTTTCAGTGATGCGATCGTTGCAGAATAGTAGAAT
TGTCAACTTGTTCACTGTTGGTGATGGGATAACATCTACTCTTACATTTG
CTGCAGCATGTGCTTCAGCCGGCATCACAGTTCTTATTGACAATGATCTT
CAAAGCTGTTCCCAGAATCATTGCATACAGTTTGAAACTGNCACAGCCAT
GGCCTTCATTAGCTGGTTTACCGCTTTACCATCTTTTCTNGTAAATTTTG
GGTCATGGCATCTCGATGGGAAGGTGTAGCATGTAA
back to top