FC931242

Overview
NameFC931242
Unique NameFC931242
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length716
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9572 contig Ccv1_Contig9572:6..721. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931242 vs. ExPASy Swiss-Prot
Match: PHOP1_DANRE (Probable phosphatase phospho1 OS=Danio rerio GN=phospho1 PE=2 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.290e-30
Identity = 83/217 (38.25%), Postives = 119/217 (54.84%), Query Frame = 2
Query:   74 SGIVVIFDFDKTIIDCDSDNFVVDELGATDLFNQLLPTMP---WNSLMDRMMKELHSQGKTIEDILEVLKRIPIHPRVVPAIK----SAHALGCELRIVSDANLFFIETILEHLGIRDCFSEINTNPGFVDEEGRLRIFPFHDFTKCSHGCNLCPPNMCKGVVIERIQASLSKEGN----KKIIYLGDGSGDYCPSLKLSEGDHVMPRKNFPLWDLI 691
            S  ++ FDFD+T++D  SD+ +V       L   L  T     +N  M R++  L  QG T   I   ++++P  P + PA+     S  +   E+  VSDAN  FIET L+H+G +  F  I TNP   D+ G L++ PFH     SH C  CP NMCK VV+ +  A   +E      +K++Y+GDG+ D+CPSL LS GD   PR++FP+  LI
Sbjct:   34 SRFLMFFDFDETLVDECSDDSMVSAAPGGVLPGWLKDTYRPGRYNEYMQRVLAYLSEQGVTPAAIRATVEKLPPCPGI-PALMHFLLSQPSRDFEVVCVSDANTVFIETWLQHMGFQPLFLRIFTNPAHFDDNGVLQLRPFH-----SHECLRCPANMCKAVVVRQYVAQRIRERGGRPYQKVLYMGDGANDFCPSLTLSPGDVAFPRRDFPMHKLI 244          
BLAST of FC931242 vs. ExPASy Swiss-Prot
Match: PHOP1_MOUSE (Phosphoethanolamine/phosphocholine phosphatase OS=Mus musculus GN=Phospho1 PE=2 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 3.635e-25
Identity = 70/210 (33.33%), Postives = 108/210 (51.43%), Query Frame = 2
Query:   83 VVIFDFDKTIIDCDSDNFVVDELGATDLFNQLLPTMP---WNSLMDRMMKELHSQGKTIEDILEVLKRIPIHPRVVPAIKSAHALGC--ELRIVSDANLFFIETILEHLGIRDCFSEINTNPGFVDEEGRLRIFPFHDFTKCSHGCNLCPPNMCKGVVIERIQASLSKEG--NKKIIYLGDGSGDYCPSLKLSEGDHVMPRKNFPLWDLI 691
            ++ FDFD+TI+D +SD+ +V       L   L  T     +N  M R+ K L  QG    D+  V + IP+ P +   ++     G   E+ ++SDAN F +E+ L   G    F  I +NP   D  G L + PFH     +H C+ CP NMCK  V+       +++G   +++ Y+GDG+ D+CP   L+ GD   PR+ +P+  LI
Sbjct:   28 LLTFDFDETIVDENSDDSIVRAAPGQQLPESLRATYREGYYNEYMQRVFKYLGEQGVRPRDLRAVYETIPLSPGMGDLLQFIAKQGSCFEVILISDANTFGVESALRAAGHHSLFRRILSNPSGPDARGLLTLRPFH-----THSCSRCPANMCKHKVLSEYLRERARDGVHFERLFYVGDGANDFCPMGLLAGGDVAFPRRGYPMHRLI 232          
BLAST of FC931242 vs. ExPASy Swiss-Prot
Match: PHOP2_XENTR (Probable phosphatase phospho2 OS=Xenopus tropicalis GN=phospho2 PE=2 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 4.747e-25
Identity = 73/220 (33.18%), Postives = 107/220 (48.64%), Query Frame = 2
Query:   83 VVIFDFDKTIIDCDSDNFVVDELGATDLFNQLLPTMP---WNSLMDRMMKELHSQGKTIEDILEVLKRIPIHPRVVPAIKSAHALG-----CELRIVSDANLFFIETILEHLGIRDCFSEINTNPGFVDEEGRLRIFPFHDFTKCSHGCNLCPPNMCKGVVIERIQASLSKEG--NKKIIYLGDGSGDYCPSLKLSEGDHVMPRKNFPLWDLIIRNPMLI 712
            +++FDFD TII+ +SD ++V  +    L N L  +     W   M R+   L  QG   ED+  ++  IP  P +   +   H +G      +  I+SD+N  FI+ IL H  + + F ++ TNP   D  G L +  FH      H C  CP N+CK  V+E   A  S       KI+Y+GDG  D CP   L +GD  MPR  + L   I ++  L+
Sbjct:    4 LLVFDFDHTIINDNSDTWIVQCVPGKKLPNGLQNSYEKGKWTEYMGRVFSYLGEQGIREEDMKRIMIAIPYTPGMTDLL---HFIGQNKDSFDCIIISDSNTIFIDWILTHANVHNVFDKVFTNPAAFDSVGNLTVQNFH-----VHHCTTCPTNLCKKKVLEEFVAKQSSNSAHYSKIVYVGDGGNDLCPVTFLKKGDIAMPRAGYTLDKHIAKDVTLV 215          
BLAST of FC931242 vs. ExPASy Swiss-Prot
Match: PHOP2_BOVIN (Pyridoxal phosphate phosphatase PHOSPHO2 OS=Bos taurus GN=PHOSPHO2 PE=2 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 3.077e-24
Identity = 68/215 (31.63%), Postives = 105/215 (48.84%), Query Frame = 2
Query:   80 IVVIFDFDKTIIDCDSDNFVVDELGATDLFNQLLPTMP---WNSLMDRMMKELHSQGKTIEDILEVLKRIPIHPRVVPAI----KSAHALGCELRIVSDANLFFIETILEHLGIRDCFSEINTNPGFVDEEGRLRIFPFHDFTKCSHGCNLCPPNMCKGVVIERIQASLSKEG--NKKIIYLGDGSGDYCPSLKLSEGDHVMPRKNFPLWDLIIR 697
            I+++FDFD TIID +SD ++V       L  +L  +     W   M R+ K L  +G   +++   +  +P  P +V  +    K+ +   C   I+SD+N  FI+ +LE     D F ++ TNP   D  G L +   H     +H C  CP N+CK VV+        ++G    +I+Y+GDG  D CP   L + D  MPRK + L   + R
Sbjct:    3 ILLVFDFDNTIIDDNSDTWIVQCAPEKKLPLELKDSYKKGFWTEFMGRVFKYLGDEGVREDEMKRAMISMPFTPGMVELLNFIRKNKNKFDCI--IISDSNSVFIDWVLEATNFHDVFDKVFTNPAAFDSNGHLTVEKHH-----THSCTRCPQNLCKNVVLVEFVGEQLQQGVNYTRIVYIGDGGNDVCPVTFLKKNDIAMPRKGYALQKTLYR 210          
BLAST of FC931242 vs. ExPASy Swiss-Prot
Match: PHOP1_HUMAN (Phosphoethanolamine/phosphocholine phosphatase OS=Homo sapiens GN=PHOSPHO1 PE=1 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 4.019e-24
Identity = 69/210 (32.86%), Postives = 106/210 (50.48%), Query Frame = 2
Query:   83 VVIFDFDKTIIDCDSDNFVVDELGATDLFNQLLPTMP---WNSLMDRMMKELHSQGKTIEDILEVLKRIPIHPRVVPAIKSAHALGC--ELRIVSDANLFFIETILEHLGIRDCFSEINTNPGFVDEEGRLRIFPFHDFTKCSHGCNLCPPNMCKGVVIERIQASLSKEG--NKKIIYLGDGSGDYCPSLKLSEGDHVMPRKNFPLWDLI 691
            ++ FDFD+TI+D +SD+ +V       L   L  T     +N  M R+ K L  QG    D+  + + IP+ P +   ++     G   E+ ++SDAN F +E+ L   G    F  I +NP   D  G L + PFH     +H C  CP NMCK  V+       + +G   +++ Y+GDG+ D+CP   L+ GD   PR+ +P+  LI
Sbjct:   28 LLTFDFDETIVDENSDDSIVRAAPGQRLPESLRATYREGFYNEYMQRVFKYLGEQGVRPRDLSAIYEAIPLSPGMSDLLQFVAKQGACFEVILISDANTFGVESSLRAAGHHSLFRRILSNPSGPDARGLLALRPFH-----THSCARCPANMCKHKVLSDYLRERAHDGVHFERLFYVGDGANDFCPMGLLAGGDVAFPRRGYPMHRLI 232          
BLAST of FC931242 vs. ExPASy Swiss-Prot
Match: PHOP2_HUMAN (Pyridoxal phosphate phosphatase PHOSPHO2 OS=Homo sapiens GN=PHOSPHO2 PE=1 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.994e-23
Identity = 71/215 (33.02%), Postives = 105/215 (48.84%), Query Frame = 2
Query:   80 IVVIFDFDKTIIDCDSDNFVVDELGATDLFNQLLPTMP---WNSLMDRMMKELHSQGKTIEDILEVLKRIPIHPRVVPAI----KSAHALGCELRIVSDANLFFIETILEHLGIRDCFSEINTNPGFVDEEGRLRIFPFHDFTKCSHGCNLCPPNMCKGVV-IERIQASLSKEGN-KKIIYLGDGSGDYCPSLKLSEGDHVMPRKNFPLWDLIIR 697
            I+++FDFD TIID +SD ++V       L  +L  +     W   M R+ K L  +G    ++   +  +P  P +V       K+     C   I+SD+N  FI+ +LE     D F ++ TNP   +  G L +  +H     +H CN CP N+CK VV IE +   L +  N  +I+Y+GDG  D CP   L   D  MPRK + L   + R
Sbjct:    3 ILLVFDFDNTIIDDNSDTWIVQCAPNKKLPIELRDSYRKGFWTEFMGRVFKYLGDKGVREHEMKRAVTSLPFTPGMVELFNFIRKNKDKFDCI--IISDSNSVFIDWVLEAASFHDIFDKVFTNPAAFNSNGHLTVENYH-----THSCNRCPKNLCKKVVLIEFVDKQLQQGVNYTQIVYIGDGGNDVCPVTFLKNDDVAMPRKGYTLQKTLSR 210          
BLAST of FC931242 vs. ExPASy Swiss-Prot
Match: PHOP2_MOUSE (Pyridoxal phosphate phosphatase PHOSPHO2 OS=Mus musculus GN=Phospho2 PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.293e-22
Identity = 65/209 (31.10%), Postives = 101/209 (48.33%), Query Frame = 2
Query:   80 IVVIFDFDKTIIDCDSDNFVVDELGATDLFNQLLPTMP---WNSLMDRMMKELHSQGKTIEDILEVLKRIPIHPRVVPAIK----SAHALGCELRIVSDANLFFIETILEHLGIRDCFSEINTNPGFVDEEGRLRIFPFHDFTKCSHGCNLCPPNMCKGVVI-ERIQASLSKEGN-KKIIYLGDGSGDYCPSLKLSEGDHVMPRKNFPL 679
            ++++FDFD TIID +SD ++V       L  +L  +     W   M R+ K L  +G   +++   +  +P    ++  +     +     C   I+SD+N  FI+ +LE     D F  + TNP   D  GRL +  +H     +H C  CP N+CK  V+ E I   L K     +I+Y+GDG  D CP   L + D  MPR+ + L
Sbjct:    3 VLLVFDFDNTIIDDNSDTWIVQCAPDKKLPIELQDSYQKGLWTEFMGRVFKYLRDEGVKADELKRAVTSLPFTSGMIELLSFLRMNKDRFDCI--IISDSNSIFIDWVLEAAAFHDVFDHVFTNPASFDSSGRLTVKNYH-----AHSCTRCPKNLCKNTVLGEFIDKQLQKGVRYTRIVYIGDGGNDVCPVTFLKKNDVAMPREGYTL 204          
BLAST of FC931242 vs. ExPASy Swiss-Prot
Match: PHOP1_CHICK (Phosphoethanolamine/phosphocholine phosphatase OS=Gallus gallus GN=PHOSPHO1 PE=2 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 3.761e-22
Identity = 65/207 (31.40%), Postives = 105/207 (50.72%), Query Frame = 2
Query:   83 VVIFDFDKTIIDCDSDNFVVDELGATDLFNQLLPTMP---WNSLMDRMMKELHSQGKTIEDILEVLKRIPIHPRVVPA---IKSAHALGCELRIVSDANLFFIETILEHLGIRDCFSEINTNPGFVDEEGRLRIFPFHDFTKCSHGCNLCPPNMCKGVVIERIQASLSKE--GNKKIIYLGDGSGDYCPSLKLSEGDHVMPRKNFPL 679
            +++FDFD TII+  SD+ +V       L   +  +     +N  M R++  +  QG  + D   V + IP+ P +      +   H L  E+ ++SDAN+F IE  L   G    F +I +NP   D+ G   + P+H     SH C  CP N CK  ++    A  ++E    +++ Y+GDG+ D+CPS+ L+  D   PRK +P+
Sbjct:   28 LLVFDFDGTIINESSDDSIVRAAPGQALPEHIRQSFREGFYNEYMQRVLAYMGDQGVKMGDFKAVYENIPLSPGMPDLFQFLSKNHEL-FEIILISDANMFGIECKLRAAGFYSLFRKIFSNPSSFDKRGYFTLGPYH-----SHKCLDCPANTCKRKILTEYLAERAQEEVEFERVFYVGDGANDFCPSVTLTSADVAFPRKGYPM 228          
BLAST of FC931242 vs. ExPASy Swiss-Prot
Match: PHOP2_RAT (Pyridoxal phosphate phosphatase PHOSPHO2 OS=Rattus norvegicus GN=Phospho2 PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 8.379e-22
Identity = 65/209 (31.10%), Postives = 100/209 (47.85%), Query Frame = 2
Query:   80 IVVIFDFDKTIIDCDSDNFVVDELGATDLFNQLLPTMP---WNSLMDRMMKELHSQGKTIEDILEVLKRIPIHPRVVPAIK----SAHALGCELRIVSDANLFFIETILEHLGIRDCFSEINTNPGFVDEEGRLRIFPFHDFTKCSHGCNLCPPNMCKGVVI-ERIQASLSKEGN-KKIIYLGDGSGDYCPSLKLSEGDHVMPRKNFPL 679
            ++++FDFD TIID +SD +++       L  +L  +     W   M R+ K L  +G   E++   +  +P    ++  +     +     C   I+SD+N  FI+ +LE     D F  + TNP   D  GRL +   H     +H C  CP N+CK  V+ E I   L K     +I+Y+GDG  D CP   L + D  MPR+ + L
Sbjct:    3 VLLVFDFDNTIIDDNSDTWIIQCAPDKKLPIELQDSYQKGLWTEFMGRVFKYLRDEGVKEEELKRAVTSLPFTSGMIELLSFLRMNKDRFDCI--IISDSNSIFIDWVLEAAAFHDVFDTVFTNPASFDSTGRLTVRNCH-----THACTRCPKNLCKNTVLGEFIDKQLQKGVRYTRIVYIGDGGNDVCPVTFLKKNDVAMPREGYTL 204          
The following BLAST results are available for this feature:
BLAST of FC931242 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
PHOP1_DANRE1.290e-3038.25Probable phosphatase phospho1 OS=Danio rerio GN=ph... [more]
PHOP1_MOUSE3.635e-2533.33Phosphoethanolamine/phosphocholine phosphatase OS=... [more]
PHOP2_XENTR4.747e-2533.18Probable phosphatase phospho2 OS=Xenopus tropicali... [more]
PHOP2_BOVIN3.077e-2431.63Pyridoxal phosphate phosphatase PHOSPHO2 OS=Bos ta... [more]
PHOP1_HUMAN4.019e-2432.86Phosphoethanolamine/phosphocholine phosphatase OS=... [more]
PHOP2_HUMAN1.994e-2333.02Pyridoxal phosphate phosphatase PHOSPHO2 OS=Homo s... [more]
PHOP2_MOUSE1.293e-2231.10Pyridoxal phosphate phosphatase PHOSPHO2 OS=Mus mu... [more]
PHOP1_CHICK3.761e-2231.40Phosphoethanolamine/phosphocholine phosphatase OS=... [more]
PHOP2_RAT8.379e-2231.10Pyridoxal phosphate phosphatase PHOSPHO2 OS=Rattus... [more]
back to top
Properties
Property NameValue
Genbank descriptionC34103A09EF PostHarvP1 Citrus clementina cDNA clone C34103A09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931242 ID=FC931242|Name=FC931242|organism=Citrus clementina|type=EST|length=716bp
GAACAAAAATTCAGGAGAAAGTAATCAAGAATTTCGAGCTTTTTATTTTA
GCAACAGAAAGAAAAATATAATGTCTGGAATTGTTGTGATTTTCGACTTC
GACAAGACCATCATCGACTGCGATAGCGACAACTTTGTTGTTGATGAACT
GGGTGCTACGGATTTGTTCAATCAACTCCTTCCCACCATGCCCTGGAACT
CTCTCATGGACAGGATGATGAAGGAGCTTCATTCACAAGGCAAGACGATT
GAAGACATTTTGGAGGTTCTGAAGAGGATTCCGATTCATCCCAGGGTCGT
TCCTGCCATTAAATCAGCCCATGCTTTAGGGTGTGAATTGAGAATCGTCA
GTGATGCAAATTTGTTTTTCATTGAAACAATTTTGGAGCATCTTGGGATT
AGAGATTGTTTCTCTGAAATCAACACAAATCCTGGCTTTGTTGATGAAGA
AGGCAGGCTGAGAATTTTCCCTTTTCACGACTTCACCAAATGCTCTCATG
GCTGCAATCTCTGCCCGCCAAATATGTGCAAGGGCGTGGTCATTGAAAGG
ATTCAAGCTTCTTTATCTAAGGAAGGAAACAAGAAAATAATCTATCTTGG
TGATGGAAGTGGAGATTATTGTCCAAGCTTGAAGCTTAGTGAAGGAGATC
ACGTGATGCCAAGGAAAAATTTCCCATTATGGGATTTAATTATCAGGAAT
CCAATGCTCATTAAGG
back to top