FC931249

Overview
NameFC931249
Unique NameFC931249
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length698
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12090 contig Ccv1_Contig12090:827..1525. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931249 vs. ExPASy Swiss-Prot
Match: ESYT1_MOUSE (Extended synaptotagmin-1 OS=Mus musculus GN=Esyt1 PE=2 SV=2)

HSP 1 Score: 83.1889 bits (204), Expect = 1.475e-15
Identity = 57/181 (31.49%), Postives = 95/181 (52.49%), Query Frame = 1
Query:    4 VIRVIFQ-LAEEIPCISAVVVALLSEPKPRIDYTLKAVGGSLTAIPGIADMIDDTVDSIITDMLQWPHRIVVPIGGIPVDTSELELK-PQGKVAVTIVKANNLKNMEMI------GKSDPYAVVHIKPLFKVKTNVVDNNLNPVWNQTFELIAEDKETQSLIFEVFDKDIGQDKRLGIVKL 522
            V+RVI + L  ++P + AV +  +  P   I++T      +L  IPG++ + D  +   I   L  P+R++VP+     D ++L    P+G + + ++ A  L + +        GKSDPYA+V +       + V+D  LNP W +T+E+I  +   Q +  EVFDKD  +D  LG +KL
Sbjct:  232 VLRVILEPLTGDLPIVGAVSMFFIKRPTLDINWTGMT---NLLDIPGLSSLSDTMIMDSIAAFLVLPNRLLVPLVPDLQDVAQLRSPLPRGIIRIHLLAARGLSSKDKYVKGLIEGKSDPYALVRVGTQ-TFCSRVIDEELNPHWGETYEVIVHEVPGQEIEVEVFDKDPDKDDFLGRMKL 408          
BLAST of FC931249 vs. ExPASy Swiss-Prot
Match: ESYT1_RAT (Extended synaptotagmin-1 OS=Rattus norvegicus GN=Esyt1 PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.927e-15
Identity = 57/181 (31.49%), Postives = 95/181 (52.49%), Query Frame = 1
Query:    4 VIRVIFQ-LAEEIPCISAVVVALLSEPKPRIDYTLKAVGGSLTAIPGIADMIDDTVDSIITDMLQWPHRIVVPIGGIPVDTSELELK-PQGKVAVTIVKANNLKNMEMI------GKSDPYAVVHIKPLFKVKTNVVDNNLNPVWNQTFELIAEDKETQSLIFEVFDKDIGQDKRLGIVKL 522
            V+RVI + L  ++P + AV +  +  P   I++T      +L  IPG++ + D  +   I   L  P+R++VP+     D ++L    P+G + + ++ A  L + +        GKSDPYA+V +       + V+D  LNP W +T+E+I  +   Q +  EVFDKD  +D  LG +KL
Sbjct:  234 VLRVILEPLIGDLPIVGAVSMFFIKRPTLDINWTGMT---NLLDIPGLSSLSDTMIMDSIAAFLVLPNRLLVPLVPDLQDVAQLRSPLPRGIIRIHLLAARGLSSKDKYVKGLIEGKSDPYALVRVGTQ-TFCSRVIDEELNPHWGETYEVIVHEVPGQEIEVEVFDKDPDKDDFLGRMKL 410          
BLAST of FC931249 vs. ExPASy Swiss-Prot
Match: ESYT2_MOUSE (Extended synaptotagmin-2 OS=Mus musculus GN=Esyt2 PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.286e-15
Identity = 56/189 (29.63%), Postives = 103/189 (54.50%), Query Frame = 1
Query:    7 IRVIFQ-LAEEIPCISAVVVALLSEPKPRIDYTLKAVGGSLTAIPGIADMIDDTVDSIITDMLQWPHRIVVPIGGIPVDTSELELK-PQGKVAVTIVKANNLKNMEMI------GKSDPYAVVHI-KPLFKVKTNVVDNNLNPVWNQTFELIAEDKETQSLIFEVFDKDIGQDKRLGIVKLPLIDLEAD 546
            +RVI + L  ++P + A+ +  L +P   I++T      +L  IPG+  + D  +  II++ L  P+RI VP+    V  ++L    P+G + +  ++A +L+  +        GKSDPY ++ +   +F+ K  V+  NL+P WN+ +E +  +   Q L  E+FD+D  +D  LG + + LI++E +
Sbjct:  224 MRVILEPLIGDMPLVGALSIFFLRKPLLEINWTGLT---NLLDIPGLNGLSDTIILDIISNYLVLPNRITVPLVS-EVQIAQLRFPIPKGVLRIHFIEAQDLQGKDTYLKGLVKGKSDPYGIIRVGNQIFQSK--VIKENLSPKWNEVYEALVYEHPGQELEIELFDEDPDKDDFLGSLMIDLIEVEKE 406          
BLAST of FC931249 vs. ExPASy Swiss-Prot
Match: ESYT3_MOUSE (Extended synaptotagmin-3 OS=Mus musculus GN=Esyt3 PE=2 SV=2)

HSP 1 Score: 81.6481 bits (200), Expect = 4.292e-15
Identity = 59/183 (32.24%), Postives = 98/183 (53.55%), Query Frame = 1
Query:    7 IRVIFQ-LAEEIPCISAVVVALLSEPKPRIDYTLKAVGGSLTAIPGIADMIDDTVDSIITDMLQWPHRIVVPIG-GIPVDTSELELKPQGKVAVTIVKANNLKNMEMI----GKSDPYAVVHIKPLFKVKTNVVDNNLNPVWNQTFELIAEDKETQSLIFEVFDKDIGQDKRLGIVKLPLIDL 537
            +RVI + L  + P I AV V  L +P  +I++T      +L  +PGI ++ D  ++ +I   L  P+R+ VP+  G+ V    + L P G + V +++A  L   +      GKSDPYA V I  L   ++  +  NLNP WN+ FE +  +   Q L  +++D+D  +D  LG +++ L D+
Sbjct:  225 LRVILEPLLVDKPFIGAVTVFFLQKPHLQINWTGLT---NLLDMPGINELSDSLLEDLIAAHLVLPNRVTVPVKKGLDVTNLRVPL-PCGVIRVHLLEAKKLAQKDNFLGLGGKSDPYAKVSIG-LQHCRSRTIYKNLNPTWNEVFEFMVYEVPGQDLEVDLYDEDTDKDDFLGSLQICLGDV 402          
BLAST of FC931249 vs. ExPASy Swiss-Prot
Match: ESYT3_HUMAN (Extended synaptotagmin-3 OS=Homo sapiens GN=ESYT3 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 7.321e-15
Identity = 58/183 (31.69%), Postives = 97/183 (53.01%), Query Frame = 1
Query:    7 IRVIFQ-LAEEIPCISAVVVALLSEPKPRIDYTLKAVGGSLTAIPGIADMIDDTVDSIITDMLQWPHRIVVPIG-GIPVDTSELELKPQGKVAVTIVKANNLKNME----MIGKSDPYAVVHIKPLFKVKTNVVDNNLNPVWNQTFELIAEDKETQSLIFEVFDKDIGQDKRLGIVKLPLIDL 537
            +RVI + L  + P + AV V  L +P  +I++T      +L   PGI D+ D  ++ +I   L  P+R+ VP+  G+ +      L P G + V +++A  L   +    + GKSDPYA V I  L   ++  +  NLNP WN+ FE +  +   Q L  +++D+D  +D  LG +++ L D+
Sbjct:  221 LRVILEPLLVDKPFVGAVTVFFLQKPHLQINWTGLT---NLLDAPGINDVSDSLLEDLIATHLVLPNRVTVPVKKGLDLTNLRFPL-PCGVIRVHLLEAEQLAQKDNFLGLRGKSDPYAKVSIG-LQHFRSRTIYRNLNPTWNEVFEFMVYEVPGQDLEVDLYDEDTDRDDFLGSLQICLGDV 398          
BLAST of FC931249 vs. ExPASy Swiss-Prot
Match: ESYT2_HUMAN (Extended synaptotagmin-2 OS=Homo sapiens GN=ESYT2 PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 7.321e-15
Identity = 54/189 (28.57%), Postives = 103/189 (54.50%), Query Frame = 1
Query:    7 IRVIFQ-LAEEIPCISAVVVALLSEPKPRIDYTLKAVGGSLTAIPGIADMIDDTVDSIITDMLQWPHRIVVPIGGIPVDTSELELK-PQGKVAVTIVKANNLKNMEMI------GKSDPYAVVHI-KPLFKVKTNVVDNNLNPVWNQTFELIAEDKETQSLIFEVFDKDIGQDKRLGIVKLPLIDLEAD 546
            +RVI + L  ++P + A+ +  L +P   I++T      +L  +PG+  + D  +  II++ L  P+RI VP+    V  ++L    P+G + +  ++A +L+  +        GKSDPY ++ +   +F+  + V+  NL+P WN+ +E +  +   Q L  E+FD+D  +D  LG + + LI++E +
Sbjct:  300 MRVILEPLIGDMPLVGALSIFFLRKPLLEINWTGLT---NLLDVPGLNGLSDTIILDIISNYLVLPNRITVPLVS-EVQIAQLRFPVPKGVLRIHFIEAQDLQGKDTYLKGLVKGKSDPYGIIRVGNQIFQ--SRVIKENLSPKWNEVYEALVYEHPGQELEIELFDEDPDKDDFLGSLMIDLIEVEKE 482          
BLAST of FC931249 vs. ExPASy Swiss-Prot
Match: ESYT1_PONAB (Extended synaptotagmin-1 OS=Pongo abelii GN=ESYT1 PE=2 SV=2)

HSP 1 Score: 80.8777 bits (198), Expect = 7.321e-15
Identity = 56/181 (30.94%), Postives = 95/181 (52.49%), Query Frame = 1
Query:    4 VIRVIFQ-LAEEIPCISAVVVALLSEPKPRIDYTLKAVGGSLTAIPGIADMIDDTVDSIITDMLQWPHRIVVPIGGIPVDTSELELK-PQGKVAVTIVKANNLKNMEMI------GKSDPYAVVHIKPLFKVKTNVVDNNLNPVWNQTFELIAEDKETQSLIFEVFDKDIGQDKRLGIVKL 522
            V+RVI + L  ++P + AV +  +  P   I++T      +L  IPG++ + D  +   I   L  P+R++VP+     D ++L    P+G + + ++ A  L + +        GKSDPYA+V +       + V+D  LNP W +T+E++  +   Q +  EVFDKD  +D  LG +KL
Sbjct:  242 VLRVILEPLIGDLPIVGAVSMFFIRRPTLDINWTGMT---NLLDIPGLSSLSDTMIMDSIAAFLVLPNRLLVPLVPDLQDVAQLRSPLPRGIIRIHLLAARGLTSKDKYVKGLIEGKSDPYALVRLGTQ-TFCSRVIDEELNPQWGETYEVMVHEVPGQEIEVEVFDKDPDKDDFLGRMKL 418          
BLAST of FC931249 vs. ExPASy Swiss-Prot
Match: ESYT1_HUMAN (Extended synaptotagmin-1 OS=Homo sapiens GN=ESYT1 PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 7.321e-15
Identity = 56/181 (30.94%), Postives = 95/181 (52.49%), Query Frame = 1
Query:    4 VIRVIFQ-LAEEIPCISAVVVALLSEPKPRIDYTLKAVGGSLTAIPGIADMIDDTVDSIITDMLQWPHRIVVPIGGIPVDTSELELK-PQGKVAVTIVKANNLKNMEMI------GKSDPYAVVHIKPLFKVKTNVVDNNLNPVWNQTFELIAEDKETQSLIFEVFDKDIGQDKRLGIVKL 522
            V+RVI + L  ++P + AV +  +  P   I++T      +L  IPG++ + D  +   I   L  P+R++VP+     D ++L    P+G + + ++ A  L + +        GKSDPYA+V +       + V+D  LNP W +T+E++  +   Q +  EVFDKD  +D  LG +KL
Sbjct:  242 VLRVILEPLIGDLPFVGAVSMFFIRRPTLDINWTGMT---NLLDIPGLSSLSDTMIMDSIAAFLVLPNRLLVPLVPDLQDVAQLRSPLPRGIIRIHLLAARGLSSKDKYVKGLIEGKSDPYALVRLGTQ-TFCSRVIDEELNPQWGETYEVMVHEVPGQEIEVEVFDKDPDKDDFLGRMKL 418          
BLAST of FC931249 vs. ExPASy Swiss-Prot
Match: EST2B_XENLA (Extended synaptotagmin-2-B OS=Xenopus laevis GN=esyt2-B PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 9.561e-15
Identity = 56/189 (29.63%), Postives = 102/189 (53.97%), Query Frame = 1
Query:    7 IRVIFQ-LAEEIPCISAVVVALLSEPKPRIDYTLKAVGGSLTAIPGIADMIDDTVDSIITDMLQWPHRIVVPIGGIPVDTSELELK-PQGKVAVTIVKANNLKNMEMI------GKSDPYAVVHI-KPLFKVKTNVVDNNLNPVWNQTFELIAEDKETQSLIFEVFDKDIGQDKRLGIVKLPLIDLEAD 546
            +RVI + L  ++P + A+ +  L +P   I++T      ++  +PG+  + D  +  II++ L  P+RI VP+    V  ++L    P+G + +  ++A +L   +        GKSDPY VV +   +F+ K  V+  NLNP WN+ +E +  +   Q L  E+FD+D  +D  LG + + L+++E +
Sbjct:  232 MRVILEPLIGDVPIVGALSIFFLRKPLLEINWTGLT---NMLDMPGLNGLSDTIILDIISNYLVLPNRITVPLVS-DVQIAQLRFPIPKGVLRIHFLEAQDLMWKDTYMKGLVKGKSDPYGVVRLGNQVFQSK--VIKENLNPKWNEVYEALVHEHPGQELEIELFDEDTDKDDFLGSLLIDLVEVEKE 414          
BLAST of FC931249 vs. ExPASy Swiss-Prot
Match: EST2A_XENLA (Extended synaptotagmin-2-A OS=Xenopus laevis GN=esyt2-A PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 9.561e-15
Identity = 56/189 (29.63%), Postives = 102/189 (53.97%), Query Frame = 1
Query:    7 IRVIFQ-LAEEIPCISAVVVALLSEPKPRIDYTLKAVGGSLTAIPGIADMIDDTVDSIITDMLQWPHRIVVPIGGIPVDTSELELK-PQGKVAVTIVKANNLKNMEMI------GKSDPYAVVHI-KPLFKVKTNVVDNNLNPVWNQTFELIAEDKETQSLIFEVFDKDIGQDKRLGIVKLPLIDLEAD 546
            +RVI + L  ++P + A+ +  L +P   I++T      ++  +PG+  + D  +  II++ L  P+RI VP+    V  ++L    P+G + +  ++A +L   +        GKSDPY VV +   +F+ K  V+  NLNP WN+ +E +  +   Q L  E+FD+D  +D  LG + + L+++E +
Sbjct:  228 MRVILEPLIGDVPIVGALSIFFLRKPLLEINWTGLT---NMLDMPGLNGLSDTIILDIISNYLVLPNRITVPLVS-DVQIAQLRFPIPKGVLRIHFLEAQDLMWKDTYMKGLVKGKSDPYGVVRLGNQVFQSK--VIKENLNPKWNEVYEALVHEHPGQELEIELFDEDTDKDDFLGSLLIDLVEVEKE 410          
The following BLAST results are available for this feature:
BLAST of FC931249 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
ESYT1_MOUSE1.475e-1531.49Extended synaptotagmin-1 OS=Mus musculus GN=Esyt1 ... [more]
ESYT1_RAT1.927e-1531.49Extended synaptotagmin-1 OS=Rattus norvegicus GN=E... [more]
ESYT2_MOUSE3.286e-1529.63Extended synaptotagmin-2 OS=Mus musculus GN=Esyt2 ... [more]
ESYT3_MOUSE4.292e-1532.24Extended synaptotagmin-3 OS=Mus musculus GN=Esyt3 ... [more]
ESYT3_HUMAN7.321e-1531.69Extended synaptotagmin-3 OS=Homo sapiens GN=ESYT3 ... [more]
ESYT2_HUMAN7.321e-1528.57Extended synaptotagmin-2 OS=Homo sapiens GN=ESYT2 ... [more]
ESYT1_PONAB7.321e-1530.94Extended synaptotagmin-1 OS=Pongo abelii GN=ESYT1 ... [more]
ESYT1_HUMAN7.321e-1530.94Extended synaptotagmin-1 OS=Homo sapiens GN=ESYT1 ... [more]
EST2B_XENLA9.561e-1529.63Extended synaptotagmin-2-B OS=Xenopus laevis GN=es... [more]
EST2A_XENLA9.561e-1529.63Extended synaptotagmin-2-A OS=Xenopus laevis GN=es... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103B04EF PostHarvP1 Citrus clementina cDNA clone C34103B04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931249 ID=FC931249|Name=FC931249|organism=Citrus clementina|type=EST|length=698bp
ACTGTTATACGTGTTATCTTCCAACTTGCTGAAGAGATACCCTGCATTTC
TGCTGTTGTTGTTGCTCTACTTTCTGAGCCAAAGCCAAGAATTGACTATA
CACTGAAGGCTGTTGGTGGAAGCTTGACAGCCATTCCTGGAATTGCAGAT
ATGATCGATGATACTGTGGATTCAATCATCACAGACATGCTTCAGTGGCC
TCATAGAATTGTTGTTCCGATTGGCGGTATACCTGTGGATACTAGTGAAT
TAGAGCTTAAACCTCAGGGGAAGGTTGCAGTGACCATAGTGAAAGCGAAT
AATTTGAAGAACATGGAAATGATTGGGAAATCTGATCCATATGCTGTTGT
GCATATCAAGCCGCTATTCAAGGTTAAAACGAATGTCGTAGACAACAACC
TGAATCCTGTTTGGAATCAAACATTTGAGTTGATTGCAGAAGACAAAGAG
ACTCAGTCACTTATCTTTGAGGTTTTTGATAAGGACATTGGGCAAGATAA
GAGATTGGGAATAGTGAAACTGCCCTTGATTGATCTCGAAGCAGATACTC
CAAAAGAGGCTGAATTGAGACTCCTACCGTCACTTGATATGCTGAAAATA
AAAGATAAGAAGGACAGAGGAAGCATTACTGTAAAGGTACTATATCATGA
ATTTAACAGGAGGAGCAGTTGTCTGCTCTAGAGGAAGAGAAGAGTTCC
back to top