FC931252

Overview
NameFC931252
Unique NameFC931252
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length767
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14129 contig Ccv1_Contig14129:338..1106. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931252 vs. ExPASy Swiss-Prot
Match: PRS8B_ARATH (26S protease regulatory subunit 8 homolog B OS=Arabidopsis thaliana GN=RPT6B PE=2 SV=1)

HSP 1 Score: 385.185 bits (988), Expect = 2.141e-106
Identity = 202/232 (87.07%), Postives = 205/232 (88.36%), Query Frame = 1
Query:    1 VGEVVKVMGKNKVLVKVHPEGKYVVXXXXXXXXXXXXPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLTSLMDLKHQTKLG-SHGDNXIDILDQ 693
            VGEVVKVMGKNKVLVKVHPEGKYVV            PSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  L   +   K+      N IDILDQ
Sbjct:   85 VGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKLTPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQ 316          
BLAST of FC931252 vs. ExPASy Swiss-Prot
Match: PRS8A_ARATH (26S protease regulatory subunit 8 homolog A OS=Arabidopsis thaliana GN=RPT6A PE=2 SV=1)

HSP 1 Score: 385.185 bits (988), Expect = 2.141e-106
Identity = 202/232 (87.07%), Postives = 205/232 (88.36%), Query Frame = 1
Query:    1 VGEVVKVMGKNKVLVKVHPEGKYVVXXXXXXXXXXXXPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLTSLMDLKHQTKLG-SHGDNXIDILDQ 693
            VGEVVKVMGKNKVLVKVHPEGKYVV            PSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELL  L   +   K+      N IDILDQ
Sbjct:   85 VGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKITPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLNQLDGFEASNKIKVLMATNRIDILDQ 316          
BLAST of FC931252 vs. ExPASy Swiss-Prot
Match: PRS8_DICDI (26S protease regulatory subunit 8 OS=Dictyostelium discoideum GN=psmC5 PE=1 SV=2)

HSP 1 Score: 349.747 bits (896), Expect = 9.970e-96
Identity = 181/231 (78.35%), Postives = 197/231 (85.28%), Query Frame = 1
Query:    1 VGEVVKVMGKNKVLVKVHPEGKYVVXXXXXXXXXXXXPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLTSLMDLKHQTKLG-SHGDNXIDILD 690
            V EVVK+MGKNKVLVKV+PEGK+VV            PSTR AL+++SY LH ILP+K+DPLV+LMKVEK+PDSTYDM+GGLD+QIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELF+MAREHAPSIIFMDEIDSIGS+R ESGSG GDSEVQRTMLELL  L   +    +      N IDILD
Sbjct:   69 VAEVVKLMGKNKVLVKVNPEGKFVVDIDPTVDIAKLTPSTRAALKHESYTLHRILPNKIDPLVSLMKVEKIPDSTYDMVGGLDKQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFIMAREHAPSIIFMDEIDSIGSSRGESGSGGGDSEVQRTMLELLNQLDGFESTKNIKVLMCTNRIDILD 299          
BLAST of FC931252 vs. ExPASy Swiss-Prot
Match: PRS8_NAEFO (26S protease regulatory subunit 8 homolog OS=Naegleria fowleri PE=2 SV=1)

HSP 1 Score: 344.354 bits (882), Expect = 4.189e-94
Identity = 176/231 (76.19%), Postives = 191/231 (82.68%), Query Frame = 1
Query:    1 VGEVVKVMGKNKVLVKVHPEGKYVVXXXXXXXXXXXXPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLTSLMDLKHQTKLG-SHGDNXIDILD 690
            VGEVVKVMGK KVL+K+  EGKY+V            P  RVALRNDSY LH ILP+K+DPLV+LMKVEKVPD+TY+M+GGLD+QIKEIKEVIELPIKHPELFESLGIAQPKGV++YGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGS+MVRELFVMAREHAPSIIFMDEIDSIGS R E G G GDSEVQRTMLELL  L   +    +      N IDILD
Sbjct:   80 VGEVVKVMGKKKVLIKISQEGKYIVDIDKSIELKDLTPGVRVALRNDSYALHKILPNKIDPLVSLMKVEKVPDATYEMVGGLDEQIKEIKEVIELPIKHPELFESLGIAQPKGVIMYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGSKMVRELFVMAREHAPSIIFMDEIDSIGSTRTEGGKGGGDSEVQRTMLELLNQLDGFESTQNIKIIMATNRIDILD 310          
BLAST of FC931252 vs. ExPASy Swiss-Prot
Match: PRS8_RAT (26S protease regulatory subunit 8 OS=Rattus norvegicus GN=Psmc5 PE=1 SV=1)

HSP 1 Score: 340.887 bits (873), Expect = 4.631e-93
Identity = 179/231 (77.49%), Postives = 194/231 (83.98%), Query Frame = 1
Query:    1 VGEVVKVMGKNKVLVKVHPEGKYVVXXXXXXXXXXXXPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLTSLMDLKHQTKLG-SHGDNXIDILD 690
            VGEVV+ M K KVLVKVHPEGK+VV            P+ RVALRNDSY LH ILP+KVDPLV+LM VEKVPDSTY+MIGGLD+QIKEIKEVIELP+KHPELFE+LGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL  L   +    +      N IDILD
Sbjct:   73 VGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILD 302          
BLAST of FC931252 vs. ExPASy Swiss-Prot
Match: PRS8_PIG (26S protease regulatory subunit 8 OS=Sus scrofa GN=PSMC5 PE=2 SV=1)

HSP 1 Score: 340.887 bits (873), Expect = 4.631e-93
Identity = 179/231 (77.49%), Postives = 194/231 (83.98%), Query Frame = 1
Query:    1 VGEVVKVMGKNKVLVKVHPEGKYVVXXXXXXXXXXXXPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLTSLMDLKHQTKLG-SHGDNXIDILD 690
            VGEVV+ M K KVLVKVHPEGK+VV            P+ RVALRNDSY LH ILP+KVDPLV+LM VEKVPDSTY+MIGGLD+QIKEIKEVIELP+KHPELFE+LGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL  L   +    +      N IDILD
Sbjct:   73 VGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILD 302          
BLAST of FC931252 vs. ExPASy Swiss-Prot
Match: PRS8_MOUSE (26S protease regulatory subunit 8 OS=Mus musculus GN=Psmc5 PE=1 SV=1)

HSP 1 Score: 340.887 bits (873), Expect = 4.631e-93
Identity = 179/231 (77.49%), Postives = 194/231 (83.98%), Query Frame = 1
Query:    1 VGEVVKVMGKNKVLVKVHPEGKYVVXXXXXXXXXXXXPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLTSLMDLKHQTKLG-SHGDNXIDILD 690
            VGEVV+ M K KVLVKVHPEGK+VV            P+ RVALRNDSY LH ILP+KVDPLV+LM VEKVPDSTY+MIGGLD+QIKEIKEVIELP+KHPELFE+LGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL  L   +    +      N IDILD
Sbjct:   73 VGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILD 302          
BLAST of FC931252 vs. ExPASy Swiss-Prot
Match: PRS8_HUMAN (26S protease regulatory subunit 8 OS=Homo sapiens GN=PSMC5 PE=1 SV=1)

HSP 1 Score: 340.887 bits (873), Expect = 4.631e-93
Identity = 179/231 (77.49%), Postives = 194/231 (83.98%), Query Frame = 1
Query:    1 VGEVVKVMGKNKVLVKVHPEGKYVVXXXXXXXXXXXXPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLTSLMDLKHQTKLG-SHGDNXIDILD 690
            VGEVV+ M K KVLVKVHPEGK+VV            P+ RVALRNDSY LH ILP+KVDPLV+LM VEKVPDSTY+MIGGLD+QIKEIKEVIELP+KHPELFE+LGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL  L   +    +      N IDILD
Sbjct:   73 VGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILD 302          
BLAST of FC931252 vs. ExPASy Swiss-Prot
Match: PRS8_BOVIN (26S protease regulatory subunit 8 OS=Bos taurus GN=PSMC5 PE=2 SV=1)

HSP 1 Score: 340.887 bits (873), Expect = 4.631e-93
Identity = 179/231 (77.49%), Postives = 194/231 (83.98%), Query Frame = 1
Query:    1 VGEVVKVMGKNKVLVKVHPEGKYVVXXXXXXXXXXXXPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLTSLMDLKHQTKLG-SHGDNXIDILD 690
            VGEVV+ M K KVLVKVHPEGK+VV            P+ RVALRNDSY LH ILP+KVDPLV+LM VEKVPDSTY+MIGGLD+QIKEIKEVIELP+KHPELFE+LGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQK+IGEG+RMVRELFVMAREHAPSIIFMDEIDSIGS+R+E GSG GDSEVQRTMLELL  L   +    +      N IDILD
Sbjct:   73 VGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSG-GDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILD 302          
BLAST of FC931252 vs. ExPASy Swiss-Prot
Match: PRS8_SCHPO (26S protease regulatory subunit 8 homolog OS=Schizosaccharomyces pombe GN=let1 PE=2 SV=1)

HSP 1 Score: 340.502 bits (872), Expect = 6.048e-93
Identity = 176/231 (76.19%), Postives = 192/231 (83.12%), Query Frame = 1
Query:    1 VGEVVKVMGKNKVLVKVHPEGKYVVXXXXXXXXXXXXPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLTSLMDLKHQTKLG-SHGDNXIDILD 690
            VGEV+K MGKNKVLVKVHPEGKYVV            P+ RVALRNDSY L  ILP+KVDPLV+LM VEK+PDSTY+M+GGL++QIKEIKEVIELP+KHPELFESLGI QPKG+LLYGPPGTGKTLLARAVAHHTDC FIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS+R +S  G+GDSEVQRTMLELL  L   +    +      N IDILD
Sbjct:   69 VGEVIKTMGKNKVLVKVHPEGKYVVDISPDIDIKEIKPNIRVALRNDSYQLIKILPNKVDPLVSLMMVEKIPDSTYEMVGGLEKQIKEIKEVIELPVKHPELFESLGIPQPKGILLYGPPGTGKTLLARAVAHHTDCKFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRSDSSGGSGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILD 299          
The following BLAST results are available for this feature:
BLAST of FC931252 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 374
Match NameE-valueIdentityDescription
PRS8B_ARATH2.141e-10687.0726S protease regulatory subunit 8 homolog B OS=Ara... [more]
PRS8A_ARATH2.141e-10687.0726S protease regulatory subunit 8 homolog A OS=Ara... [more]
PRS8_DICDI9.970e-9678.3526S protease regulatory subunit 8 OS=Dictyostelium... [more]
PRS8_NAEFO4.189e-9476.1926S protease regulatory subunit 8 homolog OS=Naegl... [more]
PRS8_RAT4.631e-9377.4926S protease regulatory subunit 8 OS=Rattus norveg... [more]
PRS8_PIG4.631e-9377.4926S protease regulatory subunit 8 OS=Sus scrofa GN... [more]
PRS8_MOUSE4.631e-9377.4926S protease regulatory subunit 8 OS=Mus musculus ... [more]
PRS8_HUMAN4.631e-9377.4926S protease regulatory subunit 8 OS=Homo sapiens ... [more]
PRS8_BOVIN4.631e-9377.4926S protease regulatory subunit 8 OS=Bos taurus GN... [more]
PRS8_SCHPO6.048e-9376.1926S protease regulatory subunit 8 homolog OS=Schiz... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103B07EF PostHarvP1 Citrus clementina cDNA clone C34103B07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931252 ID=FC931252|Name=FC931252|organism=Citrus clementina|type=EST|length=767bp
GTCGGTGAAGTTGTTAAAGTTATGGGAAAAAATAAGGTTCTTGTTAAGGT
TCATCCTGAGGGGAAATATGTTGTTGATATTGATAAAAGTATTGATATAA
CCAAGATCACTCCGTCAACAAGAGTTGCACTTCGTAATGACAGCTATGTT
CTTCATTTGATCCTGCCAAGCAAAGTAGATCCCCTGGTCAACCTTATGAA
GGTTGAAAAGGTCCCTGATTCTACATATGACATGATTGGTGGCCTTGATC
AGCAAATTAAGGAGATCAAGGAGGTCATTGAGCTTCCTATCAAACATCCC
GAATTGTTCGAGTCTCTTGGAATAGCTCAACCCAAGGGTGTATTGCTATA
TGGACCACCTGGTACTGGCAAAACACTGTTGGCTAGAGCTGTGGCTCATC
ATACTGATTGTACTTTCATCAGGGTTTCTGGTTCTGAATTAGTCCAGAAA
TACATTGGAGAAGGCTCCAGAATGGTTAGAGAACTTTTTGTTATGGCAAG
GGAACATGCTCCGTCTATCATTTTTATGGATGAAATTGACAGTATTGGAT
CTGCCCGAATGGAATCTGGCAGCGGAAATGGTGACAGTGAGGTGCAGAGG
ACTATGCTGGAGCTGCTCACCAGCTTGATGGATTTGAAGCATCAAACAAA
ATTAGGTTCTCATGGCGACAATCNGATTGATATTCTCGATCAGCTCTTCT
CAGCCAGACGAATGACAGAAGATGAATTTCAAAATCTATGAGAGCTCGTC
TGATATCTAAAAATCAT
back to top