FC931254

Overview
NameFC931254
Unique NameFC931254
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length711
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC931254_ssr35 microsatellite FC931254_ssr35:35..70. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig15294 contig Ccv1_Contig15294:1..711. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931254 vs. ExPASy Swiss-Prot
Match: STP13_ARATH (Sugar transport protein 13 OS=Arabidopsis thaliana GN=STP13 PE=1 SV=2)

HSP 1 Score: 261.536 bits (667), Expect = 3.128e-69
Identity = 137/179 (76.54%), Postives = 144/179 (80.45%), Query Frame = 2
Query:  164 MPGGGFSASVPPAGVEFEAKITPIVIVSCIMAATGGLMFGYDVGVSGGVTAMPHFLKKFFPVVYRRTQQG--DDSNYCKYDNQGLQLFTSSLYLAGLTATFFASYXXXXXXXXXXXXIAGIFFIAGVAFNVAAQNLAMLIVGRILLGCGVGFANQAVPLFLSEIAPNRIRGGLTYSFSL 694
            M GGGF+ S    GVEFEAKITPIVI+SCIMAATGGLMFGYDVGVSGGVT+MP FL+KFFPVVYR+   G   DSNYCKYDNQGLQLFTSSLYLAGLTATFFASY            IAG+FFI GVA N  AQ+LAMLI GRILLGCGVGFANQAVPLFLSEIAP RIRGGL   F L
Sbjct:    1 MTGGGFATSAN--GVEFEAKITPIVIISCIMAATGGLMFGYDVGVSGGVTSMPDFLEKFFPVVYRKVVAGADKDSNYCKYDNQGLQLFTSSLYLAGLTATFFASYTTRTLGRRLTMLIAGVFFIIGVALNAGAQDLAMLIAGRILLGCGVGFANQAVPLFLSEIAPTRIRGGLNILFQL 177          
BLAST of FC931254 vs. ExPASy Swiss-Prot
Match: STP8_ARATH (Sugar transport protein 8 OS=Arabidopsis thaliana GN=STP8 PE=2 SV=2)

HSP 1 Score: 193.356 bits (490), Expect = 1.046e-48
Identity = 98/161 (60.87%), Postives = 115/161 (71.43%), Query Frame = 2
Query:  212 FEAKITPIVIVSCIMAATGGLMFGYDVGVSGGVTAMPHFLKKFFPVVYRRTQQGDDSNYCKYDNQGLQLFTSSLYLAGLTATFFASYXXXXXXXXXXXXIAGIFFIAGVAFNVAAQNLAMLIVGRILLGCGVGFANQAVPLFLSEIAPNRIRGGLTYSFSL 694
            F+AK+T  V +  I+AA GGL+FGYD+G+SGGVTAM  FLK+FFP VY R +   ++NYCKYDNQ LQLFTSSLYLA L A+FFAS             +A IFF+ GV     A N+ MLI+GRILLG GVGF NQAVPLFLSEIAP R+RGGL   F L
Sbjct:   14 FDAKMTVYVFICVIIAAVGGLIFGYDIGISGGVTAMDDFLKEFFPSVYERKKHAHENNYCKYDNQFLQLFTSSLYLAALVASFFASATCSKLGRRPTMQLASIFFLIGVGLAAGAVNIYMLIIGRILLGFGVGFGNQAVPLFLSEIAPARLRGGLNIVFQL 174          
BLAST of FC931254 vs. ExPASy Swiss-Prot
Match: STP7_ARATH (Sugar transport protein 7 OS=Arabidopsis thaliana GN=STP7 PE=2 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 9.791e-47
Identity = 94/183 (51.37%), Postives = 119/183 (65.03%), Query Frame = 2
Query:  164 MPGGGFSASVPPAGV------EFEAKITPIVIVSCIMAATGGLMFGYDVGVSGGVTAMPHFLKKFFPVVYRRTQQGDDSNYCKYDNQGLQLFTSSLYLAGLTATFFASYXXXXXXXXXXXXIAGIFFIAGVAFNVAAQNLAMLIVGRILLGCGVGFANQAVPLFLSEIAPNRIRGGLTYSFSL 694
            M GG F     P GV      +++ K+T  VI++C++AA GG +FGYD+G+SGGVT+M  FL++FF  VY + +Q  +SNYCKYDNQGL  FTSSLYLAGL +T  AS               GI F+ G   N  A NLAML+ GRI+LG G+GF NQAVPL+LSE+AP  +RGGL   F L
Sbjct:    1 MAGGSFG----PTGVAKERAEQYQGKVTSYVIIACLVAAIGGSIFGYDIGISGGVTSMDEFLEEFFHTVYEKKKQAHESNYCKYDNQGLAAFTSSLYLAGLVSTLVASPITRNYGRRASIVCGGISFLIGSGLNAGAVNLAMLLAGRIMLGVGIGFGNQAVPLYLSEVAPTHLRGGLNMMFQL 179          
BLAST of FC931254 vs. ExPASy Swiss-Prot
Match: STP6_ARATH (Sugar transport protein 6 OS=Arabidopsis thaliana GN=STP6 PE=1 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 4.859e-46
Identity = 93/161 (57.76%), Postives = 112/161 (69.57%), Query Frame = 2
Query:  212 FEAKITPIVIVSCIMAATGGLMFGYDVGVSGGVTAMPHFLKKFFPVVYRRTQQGDDSNYCKYDNQGLQLFTSSLYLAGLTATFFASYXXXXXXXXXXXXIAGIFFIAGVAFNVAAQNLAMLIVGRILLGCGVGFANQAVPLFLSEIAPNRIRGGLTYSFSL 694
            FEAK+T  V +  ++AA GGL+FGYD+G+SGGV+AM  FLK+FFP V+ R +   ++NYCKYDNQ LQLFTSSLYLA L A+F AS              A IFF+ GV     A NL MLI+GR+ LG GVGF NQAVPLFLSEIAP ++RGGL   F L
Sbjct:   13 FEAKMTVYVFICVMIAAVGGLIFGYDIGISGGVSAMDDFLKEFFPAVWERKKHVHENNYCKYDNQFLQLFTSSLYLAALVASFVASATCSKLGRRPTMQFASIFFLIGVGLTAGAVNLVMLIIGRLFLGFGVGFGNQAVPLFLSEIAPAQLRGGLNIVFQL 173          
BLAST of FC931254 vs. ExPASy Swiss-Prot
Match: STP2_ARATH (Sugar transport protein 2 OS=Arabidopsis thaliana GN=STP2 PE=1 SV=3)

HSP 1 Score: 182.956 bits (463), Expect = 1.414e-45
Identity = 96/177 (54.24%), Postives = 119/177 (67.23%), Query Frame = 2
Query:  182 SASVPPAGVEFEAKITPIVIVSCIMAATGGLMFGYDVGVSGGVTAMPHFLKKFFPVVYRRTQQGDDSNYCKYDNQGLQLFTSSLYLAGLTATFFASYXXXXXXXXXXXXIAGIFFIAGVAFNVAAQNLAMLIVGRILLGCGVGFANQAVPLFLSEIAPNRIRGGLTYSFS-LRHIGI 709
            S +V      F AK+T  V + C++AA GGLMFGYD+G+SGGVT+M  FL  FFP VY +  +  ++NYCK+D+Q LQLFTSSLYLAG+ A+F +SY            +A IFF+ G   N++AQ L MLI GRILLG G+GF NQ VPLF+SEIAP R RGGL   F  L  IGI
Sbjct:    5 SMNVEEGTKAFPAKLTGQVFLCCVIAAVGGLMFGYDIGISGGVTSMDTFLLDFFPHVYEKKHRVHENNYCKFDDQLLQLFTSSLYLAGIFASFISSYVSRAFGRKPTIMLASIFFLVGAILNLSAQELGMLIGGRILLGFGIGFGNQTVPLFISEIAPARYRGGLNVMFQFLITIGI 181          
BLAST of FC931254 vs. ExPASy Swiss-Prot
Match: STP10_ARATH (Sugar transport protein 10 OS=Arabidopsis thaliana GN=STP10 PE=2 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 2.042e-44
Identity = 91/178 (51.12%), Postives = 119/178 (66.85%), Query Frame = 2
Query:  164 MPGGGFSASVPPAGVEFEAKITPIVIVSCIMAATGGLMFGYDVGVSGGVTAMPHFLKKFFPVVYRRTQQGD-DSNYCKYDNQGLQLFTSSLYLAGLTATFFASYXXXXXXXXXXXXIAGIFFIAGVAFNVAAQNLAMLIVGRILLGCGVGFANQAVPLFLSEIAPNRIRGGLTYSFSL 694
            M GG F +     G  +E  +T  VI++CI+AA GGL+FGYD+G+SGGVT+M  FL KFFP V  + ++   D+ YCK+DNQ LQLFTSSLYLA L A+F AS             I G+ F+ G  FN  A N++MLI+GR+LLG GVGFANQ+ P++LSE+AP +IRG L   F +
Sbjct:    1 MAGGAFVSEGGGGGRSYEGGVTAFVIMTCIVAAMGGLLFGYDLGISGGVTSMEEFLTKFFPQVESQMKKAKHDTAYCKFDNQMLQLFTSSLYLAALVASFMASVITRKHGRKVSMFIGGLAFLIGALFNAFAVNVSMLIIGRLLLGVGVGFANQSTPVYLSEMAPAKIRGALNIGFQM 178          
BLAST of FC931254 vs. ExPASy Swiss-Prot
Match: STP9_ARATH (Sugar transport protein 9 OS=Arabidopsis thaliana GN=STP9 PE=1 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 1.013e-43
Identity = 90/178 (50.56%), Postives = 119/178 (66.85%), Query Frame = 2
Query:  164 MPGGGFSASVPPAGVEFEAKITPIVIVSCIMAATGGLMFGYDVGVSGGVTAMPHFLKKFFPVVYRRTQQGD-DSNYCKYDNQGLQLFTSSLYLAGLTATFFASYXXXXXXXXXXXXIAGIFFIAGVAFNVAAQNLAMLIVGRILLGCGVGFANQAVPLFLSEIAPNRIRGGLTYSFSL 694
            M GG F +     G  +E  +T  VI++CI+AA GGL+FGYD+G+SGGVT+M  FL KFFP V ++  +   ++ YCK+DNQ LQLFTSSLYLA L ++F AS             + G+ F+ G  FN  A N+AMLIVGR+LLG GVGFANQ+ P++LSE+AP +IRG L   F +
Sbjct:    1 MAGGAFVSEGGGGGNSYEGGVTVFVIMTCIVAAMGGLLFGYDLGISGGVTSMEEFLSKFFPEVDKQMHEARRETAYCKFDNQLLQLFTSSLYLAALASSFVASAVTRKYGRKISMFVGGVAFLIGSLFNAFATNVAMLIVGRLLLGVGVGFANQSTPVYLSEMAPAKIRGALNIGFQM 178          
BLAST of FC931254 vs. ExPASy Swiss-Prot
Match: STP1_ARATH (Sugar transport protein 1 OS=Arabidopsis thaliana GN=STP1 PE=1 SV=2)

HSP 1 Score: 176.792 bits (447), Expect = 1.013e-43
Identity = 92/178 (51.69%), Postives = 118/178 (66.29%), Query Frame = 2
Query:  164 MPGGGFSASVPPAGVEFEAKITPIVIVSCIMAATGGLMFGYDVGVSGGVTAMPHFLKKFFPVVYRRTQQGDDSN-YCKYDNQGLQLFTSSLYLAGLTATFFASYXXXXXXXXXXXXIAGIFFIAGVAFNVAAQNLAMLIVGRILLGCGVGFANQAVPLFLSEIAPNRIRGGLTYSFSL 694
            MP GGF   V      +  K+TP V+ +C++AA GGL+FGYD+G+SGGVT+MP FLK+FFP VYR+ Q+   +N YC+YD+  L +FTSSLYLA L ++  AS               GI F AG   N  A+++ MLIVGRILLG G+GFANQAVPL+LSE+AP + RG L   F L
Sbjct:    1 MPAGGFV--VGDGQKAYPGKLTPFVLFTCVVAAMGGLIFGYDIGISGGVTSMPSFLKRFFPSVYRKQQEDASTNQYCQYDSPTLTMFTSSLYLAALISSLVASTVTRKFGRRLSMLFGGILFCAGALINGFAKHVWMLIVGRILLGFGIGFANQAVPLYLSEMAPYKYRGALNIGFQL 176          
BLAST of FC931254 vs. ExPASy Swiss-Prot
Match: HEX6_RICCO (Hexose carrier protein HEX6 OS=Ricinus communis GN=HEX6 PE=2 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 6.568e-43
Identity = 89/168 (52.98%), Postives = 116/168 (69.05%), Query Frame = 2
Query:  188 SVPPAGVEFEAKITPIVIVSCIMAATGGLMFGYDVGVSGGVTAMPHFLKKFFPVVYRRTQQGDD-SNYCKYDNQGLQLFTSSLYLAGLTATFFASYXXXXXXXXXXXXIAGIFFIAGVAFNVAAQNLAMLIVGRILLGCGVGFANQAVPLFLSEIAPNRIRGGLTYSF 688
            ++   G ++  ++T  V +SC+MAA GG++FGYD+GVSGGVT+M  FLKKFFP VYR+ ++  + SNYCK+D+Q L  FTSSLY+AGL A+FFAS             + G  F+A  A   AA N+ MLI GR+LLG GVGFANQAVPL+LSE+AP R RG +   F
Sbjct:    6 AITSEGGQYNGRMTSFVALSCMMAAMGGVIFGYDIGVSGGVTSMDPFLKKFFPDVYRKMKEDTEISNYCKFDSQLLTSFTSSLYVAGLVASFFASSVTRAFGRKPSILLGGXVFLAXAALGGAAVNVYMLIFGRVLLGVGVGFANQAVPLYLSEMAPPRYRGAINNGF 173          
BLAST of FC931254 vs. ExPASy Swiss-Prot
Match: STP11_ARATH (Sugar transport protein 11 OS=Arabidopsis thaliana GN=STP11 PE=1 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.120e-42
Identity = 91/179 (50.84%), Postives = 118/179 (65.92%), Query Frame = 2
Query:  164 MPGGGFSASVPPAGVEFEAKITPIVIVSCIMAATGGLMFGYDVGVSGGVTAMPHFLKKFFPVVYRRTQ--QGDDSNYCKYDNQGLQLFTSSLYLAGLTATFFASYXXXXXXXXXXXXIAGIFFIAGVAFNVAAQNLAMLIVGRILLGCGVGFANQAVPLFLSEIAPNRIRGGLTYSFSL 694
            M GG F       G ++E ++T  V+++CI+AA GGL+FGYD+G+SGGV +M  FL KFFP V R+ Q  +G ++ YCKYDN+ L LFTSSLYLA L A+F AS             I  + F++G   N  A NL MLI+GR+ LG GVGFANQ+VPL+LSE+AP +IRG L   F L
Sbjct:    1 MAGGAFIDESGHGG-DYEGRVTAFVMITCIVAAMGGLLFGYDIGISGGVISMEDFLTKFFPDVLRQMQNKRGRETEYCKYDNELLTLFTSSLYLAALFASFLASTITRLFGRKVSMVIGSLAFLSGALLNGLAINLEMLIIGRLFLGVGVGFANQSVPLYLSEMAPAKIRGALNIGFQL 178          
The following BLAST results are available for this feature:
BLAST of FC931254 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
STP13_ARATH3.128e-6976.54Sugar transport protein 13 OS=Arabidopsis thaliana... [more]
STP8_ARATH1.046e-4860.87Sugar transport protein 8 OS=Arabidopsis thaliana ... [more]
STP7_ARATH9.791e-4751.37Sugar transport protein 7 OS=Arabidopsis thaliana ... [more]
STP6_ARATH4.859e-4657.76Sugar transport protein 6 OS=Arabidopsis thaliana ... [more]
STP2_ARATH1.414e-4554.24Sugar transport protein 2 OS=Arabidopsis thaliana ... [more]
STP10_ARATH2.042e-4451.12Sugar transport protein 10 OS=Arabidopsis thaliana... [more]
STP9_ARATH1.013e-4350.56Sugar transport protein 9 OS=Arabidopsis thaliana ... [more]
STP1_ARATH1.013e-4351.69Sugar transport protein 1 OS=Arabidopsis thaliana ... [more]
HEX6_RICCO6.568e-4352.98Hexose carrier protein HEX6 OS=Ricinus communis GN... [more]
STP11_ARATH1.120e-4250.84Sugar transport protein 11 OS=Arabidopsis thaliana... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103B09EF PostHarvP1 Citrus clementina cDNA clone C34103B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931254 ID=FC931254|Name=FC931254|organism=Citrus clementina|type=EST|length=711bp
GTCTCATTATCACATACTTCATCTCACAATAATCTCTTCTTCTTCTTCTT
CTTCTTCTTCTTCTTCTTCTTGTTCTTCTTCTACTTCTTCTTGTTCTTCT
TCGTAATTACGCTTAACGAGAGAATTAGAATTGGAATATCGTTTCAGTTT
TTGATAATTAAGGATGCCAGGTGGTGGATTCTCGGCGTCCGTGCCGCCGG
CCGGAGTCGAGTTTGAGGCCAAGATCACGCCGATTGTTATCGTTTCATGC
ATAATGGCCGCCACTGGAGGCCTCATGTTTGGCTACGATGTTGGTGTTTC
TGGGGGAGTGACGGCGATGCCACACTTCTTGAAGAAGTTCTTTCCAGTAG
TGTATAGGAGGACACAGCAAGGGGATGATAGCAATTACTGCAAGTACGAT
AATCAAGGGCTACAATTGTTCACATCATCCTTGTACTTGGCCGGCTTAAC
TGCCACCTTCTTTGCATCATACACAACTAGGAGGCTTGGCAGGAGGCTGA
CCATGCTGATTGCTGGTATCTTCTTCATTGCTGGTGTTGCCTTTAATGTT
GCTGCCCAGAACCTTGCCATGCTCATCGTTGGAAGGATCCTGCTTGGTTG
TGGGGTTGGTTTCGCTAATCAGGCTGTGCCATTGTTCCTATCGGAAATTG
CTCCNAACAGGATACGTGGAGGGCTTACATACTCTTTCAGCTTACGTCAC
ATCGGCATTCT
back to top