FC931255

Overview
NameFC931255
Unique NameFC931255
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length698
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15295 contig Ccv1_Contig15295:1..698. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931255 vs. ExPASy Swiss-Prot
Match: AB3C_ARATH (ABC transporter C family member 3 OS=Arabidopsis thaliana GN=ABCC3 PE=1 SV=1)

HSP 1 Score: 363.614 bits (932), Expect = 5.654e-100
Identity = 179/230 (77.83%), Postives = 200/230 (86.96%), Query Frame = 1
Query:    7 SRPNHSWPSHGKIDLRDLQVRYAPHMPFVLRGISCTFPGEKKTGIVGRTGSGKSTLIQTLFRIVEPAAXXXXXXXXXXXXXXXXXXRTRLSIIPQDPVMFEGTVRSNVDPLEEYTDEQIWEALDKCQLGDEVRKKEGKLDSKVTENGENWSMGQRQLVCLGRVLLKRRKILMLDEATASVDTATDNLIQQSLRQHFSDCTVITIAHRITSVIDSDMVLLLSHGLIEEYDS 696
            +RP  SWPS G++++RDLQVRYAPHMP VLRGI+CTF G  +TGIVGRTGSGKSTLIQTLFRIVEP+A                  R RLSIIPQDP MFEGT+RSN+DPLEEYTD+QIWEALDKCQLGDEVRKKE KLDS V+ENG+NWSMGQRQLVCLGRVLLKR KIL+LDEATASVDTATDNLIQ++LR+HFSDCTVITIAHRI+SVIDSDMVLLLS+G+IEEYD+
Sbjct: 1257 NRPEQSWPSRGEVEIRDLQVRYAPHMPLVLRGITCTFKGGLRTGIVGRTGSGKSTLIQTLFRIVEPSAGEIRIDGVNILTIGLHDLRLRLSIIPQDPTMFEGTMRSNLDPLEEYTDDQIWEALDKCQLGDEVRKKEQKLDSSVSENGDNWSMGQRQLVCLGRVLLKRSKILVLDEATASVDTATDNLIQKTLREHFSDCTVITIAHRISSVIDSDMVLLLSNGIIEEYDT 1486          
BLAST of FC931255 vs. ExPASy Swiss-Prot
Match: AB6C_ARATH (ABC transporter C family member 6 OS=Arabidopsis thaliana GN=ABCC6 PE=2 SV=2)

HSP 1 Score: 346.28 bits (887), Expect = 9.342e-95
Identity = 170/230 (73.91%), Postives = 193/230 (83.91%), Query Frame = 1
Query:    7 SRPNHSWPSHGKIDLRDLQVRYAPHMPFVLRGISCTFPGEKKTGIVGRTGSGKSTLIQTLFRIVEPAAXXXXXXXXXXXXXXXXXXRTRLSIIPQDPVMFEGTVRSNVDPLEEYTDEQIWEALDKCQLGDEVRKKEGKLDSKVTENGENWSMGQRQLVCLGRVLLKRRKILMLDEATASVDTATDNLIQQSLRQHFSDCTVITIAHRITSVIDSDMVLLLSHGLIEEYDS 696
            +RP  SWPS G+I + +LQVRY PH+P VL G++CTFPG  KTGIVGRTG GKSTLIQTLFRIVEPAA                  R+RLSIIPQDP MFEGT+RSN+DPLEEYTD+QIWEALD CQLGDEVRKKE KLDS V+ENG+NWS+GQRQLVCLGRVLLKR K+L+LDEATAS+DTATDNLIQ++LR HF+DCTVITIAHRI+SVIDSDMVLLL  GLI+E+DS
Sbjct: 1207 TRPEKSWPSRGEITICNLQVRYGPHLPMVLHGLTCTFPGGLKTGIVGRTGCGKSTLIQTLFRIVEPAAGEIRIDGINILSIGLHDLRSRLSIIPQDPTMFEGTIRSNLDPLEEYTDDQIWEALDNCQLGDEVRKKELKLDSPVSENGQNWSVGQRQLVCLGRVLLKRSKLLVLDEATASIDTATDNLIQETLRHHFADCTVITIAHRISSVIDSDMVLLLDQGLIKEHDS 1436          
BLAST of FC931255 vs. ExPASy Swiss-Prot
Match: AB7C_ARATH (ABC transporter C family member 7 OS=Arabidopsis thaliana GN=ABCC7 PE=2 SV=1)

HSP 1 Score: 341.658 bits (875), Expect = 2.301e-93
Identity = 170/230 (73.91%), Postives = 191/230 (83.04%), Query Frame = 1
Query:    7 SRPNHSWPSHGKIDLRDLQVRYAPHMPFVLRGISCTFPGEKKTGIVGRTGSGKSTLIQTLFRIVEPAAXXXXXXXXXXXXXXXXXXRTRLSIIPQDPVMFEGTVRSNVDPLEEYTDEQIWEALDKCQLGDEVRKKEGKLDSKVTENGENWSMGQRQLVCLGRVLLKRRKILMLDEATASVDTATDNLIQQSLRQHFSDCTVITIAHRITSVIDSDMVLLLSHGLIEEYDS 696
            +RP  SWP  G+I + +LQVRY PH+P VLRG++CTF G  KTGIVGRTG GKSTLIQTLFRIVEPAA                  R+RLSIIPQ+P MFEGTVRSN+DPLEEY D+QIWEALDKCQLGDE+RKKE KLDS V+ENG+NWS+GQRQLVCLGRVLLKR K+L+LDEATASVDTATD LIQ++LRQHFS CTVITIAHRI+SVIDSDMVLLL  GLIEE+DS
Sbjct: 1229 TRPEKSWPCRGEITICNLQVRYGPHLPMVLRGLTCTFRGGLKTGIVGRTGCGKSTLIQTLFRIVEPAAGEIRIDGINILTIGLHDLRSRLSIIPQEPTMFEGTVRSNLDPLEEYADDQIWEALDKCQLGDEIRKKELKLDSPVSENGQNWSVGQRQLVCLGRVLLKRSKVLILDEATASVDTATDTLIQETLRQHFSGCTVITIAHRISSVIDSDMVLLLDQGLIEEHDS 1458          
BLAST of FC931255 vs. ExPASy Swiss-Prot
Match: AB5C_ARATH (ABC transporter C family member 5 OS=Arabidopsis thaliana GN=ABCC5 PE=2 SV=2)

HSP 1 Score: 296.59 bits (758), Expect = 8.489e-80
Identity = 147/229 (64.19%), Postives = 178/229 (77.73%), Query Frame = 1
Query:   10 RPNHSWPSHGKIDLRDLQVRYAPHMPFVLRGISCTFPGEKKTGIVGRTGSGKSTLIQTLFRIVEPAAXXXXXXXXXXXXXXXXXXRTRLSIIPQDPVMFEGTVRSNVDPLEEYTDEQIWEALDKCQLGDEVRKKEGKLDSKVTENGENWSMGQRQLVCLGRVLLKRRKILMLDEATASVDTATDNLIQQSLRQHFSDCTVITIAHRITSVIDSDMVLLLSHGLIEEYDS 696
            RP  SWP+ G I+L D++VRYA ++P VL G+SC FPG KK GIVGRTGSGKSTLIQ LFR++EP A                  R+RL IIPQDP +FEGT+R+N+DPLEE++D++IWEALDK QLGD VR K+ KLDS V ENG+NWS+GQRQLV LGR LLK+ KIL+LDEATASVDTATDNLIQ+ +R  F DCTV TIAHRI +VIDSD+VL+LS G + E+D+
Sbjct: 1257 RPPSSWPATGTIELVDVKVRYAENLPTVLHGVSCVFPGGKKIGIVGRTGSGKSTLIQALFRLIEPTAGKITIDNIDISQIGLHDLRSRLGIIPQDPTLFEGTIRANLDPLEEHSDDKIWEALDKSQLGDVVRGKDLKLDSPVLENGDNWSVGQRQLVSLGRALLKQAKILVLDEATASVDTATDNLIQKIIRTEFEDCTVCTIAHRIPTVIDSDLVLVLSDGRVAEFDT 1485          
BLAST of FC931255 vs. ExPASy Swiss-Prot
Match: AB9C_ARATH (ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 2.091e-78
Identity = 143/229 (62.45%), Postives = 174/229 (75.98%), Query Frame = 1
Query:   10 RPNHSWPSHGKIDLRDLQVRYAPHMPFVLRGISCTFPGEKKTGIVGRTGSGKSTLIQTLFRIVEPAAXXXXXXXXXXXXXXXXXXRTRLSIIPQDPVMFEGTVRSNVDPLEEYTDEQIWEALDKCQLGDEVRKKEGKLDSKVTENGENWSMGQRQLVCLGRVLLKRRKILMLDEATASVDTATDNLIQQSLRQHFSDCTVITIAHRITSVIDSDMVLLLSHGLIEEYDS 696
            RP  +WP+ G I  RDLQVRYA H P VL+ I+C FPG KK G+VGRTGSGKSTLIQ LFRIVEP+                   R+RL IIPQDP +F+GT+R N+DPL +YTD +IWEA+DKCQLGD +R K+ +LD+ V ENGENWS+GQRQLVCLGRVLLK+  IL+LDEATASVD+ATD +IQ+ + Q F D TV+TIAHRI +VI+SD+VL+LS G I E+DS
Sbjct: 1228 RPLDNWPNVGSIVFRDLQVRYAEHFPAVLKNITCEFPGGKKIGVVGRTGSGKSTLIQALFRIVEPSQGTIVIDNVDITKIGLHDLRSRLGIIPQDPALFDGTIRLNLDPLAQYTDHEIWEAIDKCQLGDVIRAKDERLDATVVENGENWSVGQRQLVCLGRVLLKKSNILVLDEATASVDSATDGVIQKIINQEFKDRTVVTIAHRIHTVIESDLVLVLSDGRIAEFDS 1456          
BLAST of FC931255 vs. ExPASy Swiss-Prot
Match: AB15C_ARATH (Putative ABC transporter C family member 15 OS=Arabidopsis thaliana GN=ABCC15 PE=5 SV=1)

HSP 1 Score: 290.426 bits (742), Expect = 6.083e-78
Identity = 144/229 (62.88%), Postives = 173/229 (75.55%), Query Frame = 1
Query:   10 RPNHSWPSHGKIDLRDLQVRYAPHMPFVLRGISCTFPGEKKTGIVGRTGSGKSTLIQTLFRIVEPAAXXXXXXXXXXXXXXXXXXRTRLSIIPQDPVMFEGTVRSNVDPLEEYTDEQIWEALDKCQLGDEVRKKEGKLDSKVTENGENWSMGQRQLVCLGRVLLKRRKILMLDEATASVDTATDNLIQQSLRQHFSDCTVITIAHRITSVIDSDMVLLLSHGLIEEYDS 696
            RP  +WP+ G I  RDLQVRYA H P VL+ I+C FPG KK G+VGRTGSGKSTLIQ LFRIVEP+                   R+RL IIPQD  +F+GT+R N+DPL +YTD +IWEALDKCQLGD +R K+ KLD+ V ENGENWS+GQRQLVCLGRVLLK+  IL+LDEATASVD+ATD +IQ+ + Q F D TV+TIAHRI +VI+SD+VL+LS G I E+DS
Sbjct:  775 RPLDNWPNVGSIVFRDLQVRYAEHFPAVLKNITCAFPGGKKIGVVGRTGSGKSTLIQALFRIVEPSHGTIVIDNVDITKIGLHDLRSRLGIIPQDNALFDGTIRLNLDPLAQYTDREIWEALDKCQLGDVIRAKDEKLDATVVENGENWSVGQRQLVCLGRVLLKKSNILVLDEATASVDSATDGVIQKIINQEFKDRTVVTIAHRIHTVIESDLVLVLSDGRIAEFDS 1003          
BLAST of FC931255 vs. ExPASy Swiss-Prot
Match: AB14C_ARATH (ABC transporter C family member 14 OS=Arabidopsis thaliana GN=ABCC14 PE=1 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 1.714e-72
Identity = 131/232 (56.47%), Postives = 172/232 (74.14%), Query Frame = 1
Query:    1 RKSRPNHSWPSHGKIDLRDLQVRYAPHMPFVLRGISCTFPGEKKTGIVGRTGSGKSTLIQTLFRIVEPAAXXXXXXXXXXXXXXXXXXRTRLSIIPQDPVMFEGTVRSNVDPLEEYTDEQIWEALDKCQLGDEVRKKEGKLDSKVTENGENWSMGQRQLVCLGRVLLKRRKILMLDEATASVDTATDNLIQQSLRQHFSDCTVITIAHRITSVIDSDMVLLLSHGLIEEYDS 696
            ++SRP  +WP  G I L D++VRY P+ P VL+G++    G +K G+VGRTGSGKSTLIQ LFR+VEP+                   R+R  IIPQ+PV+FEGTVRSN+DP E+Y+DE+IW++L++CQL D V  K  KLDS V +NGENWS+GQRQL+CLGRV+LKR +IL LDEATASVD+ TD +IQ+ +R+ FSDCT+I+IAHRI +V+D D VL++  G  +EYDS
Sbjct: 1283 KESRPPPNWPYKGNIRLEDVKVRYRPNTPLVLKGLTIDIKGGEKIGVVGRTGSGKSTLIQVLFRLVEPSGGKIIIDGIDICTLGLHDLRSRFGIIPQEPVLFEGTVRSNIDPTEKYSDEEIWKSLERCQLKDVVASKPEKLDSLVADNGENWSVGQRQLLCLGRVMLKRSRILFLDEATASVDSQTDAMIQKIIREDFSDCTIISIAHRIPTVMDCDRVLVIDAGKAKEYDS 1514          
BLAST of FC931255 vs. ExPASy Swiss-Prot
Match: AB4C_ARATH (ABC transporter C family member 4 OS=Arabidopsis thaliana GN=ABCC4 PE=1 SV=2)

HSP 1 Score: 268.855 bits (686), Expect = 1.895e-71
Identity = 127/232 (54.74%), Postives = 171/232 (73.71%), Query Frame = 1
Query:    1 RKSRPNHSWPSHGKIDLRDLQVRYAPHMPFVLRGISCTFPGEKKTGIVGRTGSGKSTLIQTLFRIVEPAAXXXXXXXXXXXXXXXXXXRTRLSIIPQDPVMFEGTVRSNVDPLEEYTDEQIWEALDKCQLGDEVRKKEGKLDSKVTENGENWSMGQRQLVCLGRVLLKRRKILMLDEATASVDTATDNLIQQSLRQHFSDCTVITIAHRITSVIDSDMVLLLSHGLIEEYDS 696
            +++ P  +WP HG + L DL+VRY P+ P VL+GI+    G +K G+VGRTGSGKSTLIQ LFR+VEP+                   R+R  IIPQ+PV+FEGTVRSN+DP E+Y+DE+IW++L++CQL D V  K  KLDS V +NGENWS+GQRQL+CLGRV+LKR ++L LDEATASVD+ TD +IQ+ +R+ F+ CT+I+IAHRI +V+D D VL++  G  +E+DS
Sbjct: 1260 KETLPPSNWPFHGNVHLEDLKVRYRPNTPLVLKGITLDIKGGEKVGVVGRTGSGKSTLIQVLFRLVEPSGGKIIIDGIDISTLGLHDLRSRFGIIPQEPVLFEGTVRSNIDPTEQYSDEEIWKSLERCQLKDVVATKPEKLDSLVVDNGENWSVGQRQLLCLGRVMLKRSRLLFLDEATASVDSQTDAVIQKIIREDFASCTIISIAHRIPTVMDGDRVLVIDAGKAKEFDS 1491          
BLAST of FC931255 vs. ExPASy Swiss-Prot
Match: AB8C_ARATH (ABC transporter C family member 8 OS=Arabidopsis thaliana GN=ABCC8 PE=2 SV=2)

HSP 1 Score: 268.085 bits (684), Expect = 3.233e-71
Identity = 130/229 (56.77%), Postives = 172/229 (75.11%), Query Frame = 1
Query:   10 RPNHSWPSHGKIDLRDLQVRYAPHMPFVLRGISCTFPGEKKTGIVGRTGSGKSTLIQTLFRIVEPAAXXXXXXXXXXXXXXXXXXRTRLSIIPQDPVMFEGTVRSNVDPLEEYTDEQIWEALDKCQLGDEVRKKEGKLDS-KVTENGENWSMGQRQLVCLGRVLLKRRKILMLDEATASVDTATDNLIQQSLRQHFSDCTVITIAHRITSVIDSDMVLLLSHGLIEEYD 693
            RP  SWPS+G I L++L++RY P+ P VL+GISCTF    + G+VGRTGSGKSTLI  LFR+VEPA+                  R +LSIIPQ+P +F G +R+N+DPL  Y+D++IW+AL+KCQL   +     KLDS +V++ GENWS+GQRQL CLGRVLLKR KIL+LDEATAS+D+ATD +IQ+ +R+ F+DCTVIT+AHR+ +VIDSDMV++LS G + EY+
Sbjct: 1034 RPPSSWPSNGTIHLQELKIRYRPNAPLVLKGISCTFREGTRVGVVGRTGSGKSTLISALFRLVEPASGCILIDGIDISKIGLKDLRMKLSIIPQEPTLFRGCIRTNLDPLGVYSDDEIWKALEKCQLKTTISNLPNKLDSSEVSDEGENWSVGQRQLFCLGRVLLKRNKILVLDEATASIDSATDAIIQRIIREEFADCTVITVAHRVPTVIDSDMVMVLSFGDLVEYN 1262          
BLAST of FC931255 vs. ExPASy Swiss-Prot
Match: AB10C_ARATH (ABC transporter C family member 10 OS=Arabidopsis thaliana GN=ABCC10 PE=2 SV=1)

HSP 1 Score: 262.307 bits (669), Expect = 1.774e-69
Identity = 126/230 (54.78%), Postives = 165/230 (71.74%), Query Frame = 1
Query:    4 KSRPNHSWPSHGKIDLRDLQVRYAPHMPFVLRGISCTFPGEKKTGIVGRTGSGKSTLIQTLFRIVEPAAXXXXXXXXXXXXXXXXXXRTRLSIIPQDPVMFEGTVRSNVDPLEEYTDEQIWEALDKCQLGDEVRKKEGKLDSKVTENGENWSMGQRQLVCLGRVLLKRRKILMLDEATASVDTATDNLIQQSLRQHFSDCTVITIAHRITSVIDSDMVLLLSHGLIEEYD 693
            ++RP  +WP  G++++ DLQ+RY    P VL+GISCTF G  K GIVGRTGSGK+TLI  LFR+VEP                    R+R  IIPQDP +F GTVR N+DPL +++D +IWE L KCQL + V++KE  LDS V E+G NWSMGQRQL CLGR +L+R ++L+LDEATAS+D ATD ++Q+++R+ F+DCTVIT+AHRI +V+D  MVL +S G I EYD
Sbjct: 1130 ETRPPVNWPVTGRVEISDLQIRYRRESPLVLKGISCTFEGGHKIGIVGRTGSGKTTLISALFRLVEPVGGKIVVDGVDISKIGVHDLRSRFGIIPQDPTLFNGTVRFNLDPLCQHSDAEIWEVLGKCQLKEVVQEKENGLDSLVVEDGSNWSMGQRQLFCLGRAVLRRSRVLVLDEATASIDNATDLILQKTIRREFADCTVITVAHRIPTVMDCTMVLSISDGRIVEYD 1359          
The following BLAST results are available for this feature:
BLAST of FC931255 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 455
Match NameE-valueIdentityDescription
AB3C_ARATH5.654e-10077.83ABC transporter C family member 3 OS=Arabidopsis t... [more]
AB6C_ARATH9.342e-9573.91ABC transporter C family member 6 OS=Arabidopsis t... [more]
AB7C_ARATH2.301e-9373.91ABC transporter C family member 7 OS=Arabidopsis t... [more]
AB5C_ARATH8.489e-8064.19ABC transporter C family member 5 OS=Arabidopsis t... [more]
AB9C_ARATH2.091e-7862.45ABC transporter C family member 9 OS=Arabidopsis t... [more]
AB15C_ARATH6.083e-7862.88Putative ABC transporter C family member 15 OS=Ara... [more]
AB14C_ARATH1.714e-7256.47ABC transporter C family member 14 OS=Arabidopsis ... [more]
AB4C_ARATH1.895e-7154.74ABC transporter C family member 4 OS=Arabidopsis t... [more]
AB8C_ARATH3.233e-7156.77ABC transporter C family member 8 OS=Arabidopsis t... [more]
AB10C_ARATH1.774e-6954.78ABC transporter C family member 10 OS=Arabidopsis ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103B10EF PostHarvP1 Citrus clementina cDNA clone C34103B10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931255 ID=FC931255|Name=FC931255|organism=Citrus clementina|type=EST|length=698bp
AGAAAAAGTCGGCCCAACCATTCTTGGCCATCACATGGGAAGATTGACCT
GCGTGATCTTCAGGTTCGCTATGCACCACACATGCCCTTTGTGTTGCGAG
GTATCTCGTGTACTTTCCCAGGGGAAAAGAAAACTGGTATTGTAGGGAGG
ACGGGCAGTGGTAAATCAACTCTCATTCAAACACTGTTCCGGATTGTTGA
ACCTGCTGCTGGTCAGATTCTTATAGATGGCATCGATATCTCATTGATTG
GACTACATGATTTGCGGACAAGACTAAGCATTATTCCCCAGGATCCTGTC
ATGTTTGAAGGGACTGTGCGAAGCAATGTAGACCCTCTTGAAGAATATAC
GGATGAGCAAATATGGGAGGCTCTGGATAAATGCCAACTTGGAGATGAAG
TTAGGAAGAAGGAAGGGAAACTAGATTCAAAAGTTACTGAGAATGGAGAG
AACTGGAGCATGGGCCAGAGACAGCTGGTATGTCTTGGCCGTGTGCTACT
GAAAAGAAGAAAAATCTTGATGCTTGATGAAGCTACGGCATCTGTTGACA
CTGCTACTGATAATCTGATCCAACAAAGTCTCCGGCAGCACTTCTCTGAC
TGCACAGTCATAACCATTGCTCATCGGATAACGTCTGTTATTGACAGTGA
TATGGTTCTGCTTCTCAGTCATGGACTCATCGAGGAATATGATTCCCC
back to top