FC931308

Overview
NameFC931308
Unique NameFC931308
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length693
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931308 vs. ExPASy Swiss-Prot
Match: ILVH_GUITH (Acetolactate synthase small subunit OS=Guillardia theta GN=ilvH PE=3 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.391e-18
Identity = 44/78 (56.41%), Postives = 61/78 (78.21%), Query Frame = 2
Query:  452 HTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISKLMQQLYKLIDLHEVRDLTHLP 685
            HTLS+LV D  GVL  + G+FARRG+NI+SLAVG  E  G+SRIT VVP+ + +I +L +QLYKL+++ +V D+T+LP
Sbjct:    3 HTLSVLVEDESGVLTRIAGLFARRGFNIESLAVGPTEKLGISRITMVVPSDERTIEQLTKQLYKLVNILKVEDITNLP 80          

HSP 2 Score: 78.9518 bits (193), Expect = 2.735e-14
Identity = 42/71 (59.15%), Postives = 53/71 (74.65%), Query Frame = 2
Query:    2 MLIKVNADPKFRAEIRWLVDIFRAKIVDISEYSLTIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRRE 214
            MLIK+      R E   +++IFRAK+VD+SE  L IEVTGDPGK+VA+++ LSKF I EI RTGKI+L RE
Sbjct:   87 MLIKLRVSTFERTEALDIINIFRAKVVDLSEDFLIIEVTGDPGKIVAIEQILSKFTISEIVRTGKISLVRE 157          
BLAST of FC931308 vs. ExPASy Swiss-Prot
Match: ILVH_SYNY3 (Acetolactate synthase small subunit OS=Synechocystis sp. (strain PCC 6803) GN=ilvH PE=3 SV=2)

HSP 1 Score: 90.8929 bits (224), Expect = 6.955e-18
Identity = 46/71 (64.79%), Postives = 59/71 (83.10%), Query Frame = 2
Query:    2 MLIKVNADPKFRAEIRWLVDIFRAKIVDISEYSLTIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRRE 214
            ML+KV+A+   RAE+  L  +FRA+IVDISE ++TIEV GDPGKMVA+ + L+KFGI+E+ARTGKIAL RE
Sbjct:   87 MLVKVSANAPNRAEVIELAQVFRARIVDISEDTVTIEVVGDPGKMVAILQMLAKFGIKEVARTGKIALVRE 157          

HSP 2 Score: 88.9669 bits (219), Expect = 2.643e-17
Identity = 43/78 (55.13%), Postives = 59/78 (75.64%), Query Frame = 2
Query:  452 HTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISKLMQQLYKLIDLHEVRDLTHLP 685
            HTLS+LV D  GVL  + G+FARRG+NI+SLAVG AE   +SRIT VVP  + +I +L +QLYKL+++ +V+D+T  P
Sbjct:    3 HTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGSAEQGDVSRITMVVPGDENTIEQLTKQLYKLVNVIKVQDITETP 80          
BLAST of FC931308 vs. ExPASy Swiss-Prot
Match: ILVH_CYACA (Acetolactate synthase small subunit OS=Cyanidium caldarium GN=ilvH PE=3 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.186e-17
Identity = 42/78 (53.85%), Postives = 61/78 (78.21%), Query Frame = 2
Query:  452 HTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISKLMQQLYKLIDLHEVRDLTHLP 685
            +TLS+LV D  GVL  + G+FARRG+NI+SLAVG AE +G+SRIT VVP  D ++ +L +QLYKL+++ +V ++T +P
Sbjct:    3 YTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQKGISRITMVVPGDDRTVEQLTKQLYKLVNILKVDNITEIP 80          

HSP 2 Score: 84.3445 bits (207), Expect = 6.510e-16
Identity = 41/70 (58.57%), Postives = 54/70 (77.14%), Query Frame = 2
Query:    2 MLIKVNADPKFRAEIRWLVDIFRAKIVDISEYSLTIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRR 211
            +L+K+NA    R EI  ++ +FRAK+VD+SE  L +E+TGDPGK+ A+Q+ L KFGI EIARTGKIAL R
Sbjct:   87 ILVKINASTSSRPEILSILQVFRAKVVDLSENLLVLELTGDPGKVAAIQQLLQKFGIIEIARTGKIALTR 156          
BLAST of FC931308 vs. ExPASy Swiss-Prot
Match: ILVH_PORYE (Acetolactate synthase small subunit OS=Porphyra yezoensis GN=ilvH PE=3 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 4.508e-17
Identity = 43/78 (55.13%), Postives = 61/78 (78.21%), Query Frame = 2
Query:  452 HTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISKLMQQLYKLIDLHEVRDLTHLP 685
            HTLS+LV D  GVL+ ++G+FARRG+NI SLAVG AE  G+SRIT VV   + +I +L +QLYKL+++  V+D+T++P
Sbjct:    3 HTLSVLVQDEAGVLSRISGLFARRGFNIASLAVGPAEQIGVSRITMVVQGDNRTIEQLTKQLYKLVNILNVQDVTNIP 80          

HSP 2 Score: 81.2629 bits (199), Expect = 5.511e-15
Identity = 44/70 (62.86%), Postives = 54/70 (77.14%), Query Frame = 2
Query:    2 MLIKVNADPKFRAEIRWLVDIFRAKIVDISEYSLTIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRR 211
            MLIK+  + + R E   +V IFRAKIVDI+E  L IEVTGDPGK+VA+++ L+KFGI EIARTGKI L R
Sbjct:   87 MLIKIQINSQTRTEALEIVRIFRAKIVDIAEDLLIIEVTGDPGKIVAIEQLLTKFGIIEIARTGKILLVR 156          
BLAST of FC931308 vs. ExPASy Swiss-Prot
Match: ILVH_PORPU (Acetolactate synthase small subunit OS=Porphyra purpurea GN=ilvH PE=3 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 4.508e-17
Identity = 43/78 (55.13%), Postives = 61/78 (78.21%), Query Frame = 2
Query:  452 HTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISKLMQQLYKLIDLHEVRDLTHLP 685
            HTLS+LV D  GVL+ ++G+FARRG+NI SLAVG AE  G+SRIT VV   + +I +L +QLYKL+++  V+D+T++P
Sbjct:    3 HTLSVLVQDEAGVLSRISGLFARRGFNIASLAVGPAEQIGVSRITMVVQGDNRTIEQLTKQLYKLVNILNVQDVTNIP 80          

HSP 2 Score: 78.5666 bits (192), Expect = 3.572e-14
Identity = 40/70 (57.14%), Postives = 54/70 (77.14%), Query Frame = 2
Query:    2 MLIKVNADPKFRAEIRWLVDIFRAKIVDISEYSLTIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRR 211
            MLIK+  + + R E   +V IFRA +VDI+E  + +EVTGDPGK+VA+++ L+KFGI EIARTGKI+L R
Sbjct:   87 MLIKIQVNSQNRIEALEIVKIFRANVVDIAEDLIIVEVTGDPGKIVAIEQLLTKFGIIEIARTGKISLVR 156          
BLAST of FC931308 vs. ExPASy Swiss-Prot
Match: ILVH_GALSU (Acetolactate synthase small subunit OS=Galdieria sulphuraria GN=ilvH PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 4.985e-16
Identity = 39/78 (50.00%), Postives = 59/78 (75.64%), Query Frame = 2
Query:  452 HTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISKLMQQLYKLIDLHEVRDLTHLP 685
            HTLS+LV D  GVL  ++G+FARRG+NI SLAVG AE  G+SRIT V+   +  I ++ + LYKL+++ +++D+T++P
Sbjct:    3 HTLSVLVEDESGVLTRISGLFARRGFNIDSLAVGPAEKAGISRITMVIRGDNRIIEQITKHLYKLVNVLKIQDITNIP 80          

HSP 2 Score: 80.4925 bits (197), Expect = 9.400e-15
Identity = 40/71 (56.34%), Postives = 53/71 (74.65%), Query Frame = 2
Query:    2 MLIKVNADPKFRAEIRWLVDIFRAKIVDISEYSLTIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRRE 214
            MLIKV      R EI  + +IFRA++VD+SE  + +E+TGDPGK+ A+++ L K+GI EIARTGKIAL RE
Sbjct:   87 MLIKVKTGENKRNEILEIANIFRARVVDLSESFIILEITGDPGKIAAIEKLLEKYGICEIARTGKIALTRE 157          
BLAST of FC931308 vs. ExPASy Swiss-Prot
Match: ILVH_MYCLE (Acetolactate synthase small subunit OS=Mycobacterium leprae GN=ilvH PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.773e-13
Identity = 38/75 (50.67%), Postives = 57/75 (76.00%), Query Frame = 2
Query:  440 GLRSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISKLMQQLYKLIDLHEV 664
            GL +HTLS+LV D+PGVL  V  +F+RRG+NI+SLAVG  E + +SR+T VV A +  + ++ +QL+KLI++ +V
Sbjct:    3 GLPTHTLSVLVEDTPGVLARVAALFSRRGFNIESLAVGATECKTMSRMTIVVSAEETPLEQVTKQLHKLINVIKV 77          
BLAST of FC931308 vs. ExPASy Swiss-Prot
Match: ILVH_METTH (Probable acetolactate synthase small subunit OS=Methanobacterium thermoautotrophicum GN=ilvH PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 6.737e-13
Identity = 34/75 (45.33%), Postives = 52/75 (69.33%), Query Frame = 2
Query:  449 SHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISKLMQQLYKLIDLHEVRDL 673
            +H +S LV   PGVL  V G+F RRG+NI+++ VG +ET G++R+T +    D  + ++ +QL KLID+ +VRDL
Sbjct:    8 THIISALVEHKPGVLQRVAGLFTRRGFNIENITVGESETPGIARMTIIARGDDRVLEQITKQLNKLIDVIKVRDL 82          
BLAST of FC931308 vs. ExPASy Swiss-Prot
Match: ILVH_ARCFU (Probable acetolactate synthase small subunit OS=Archaeoglobus fulgidus GN=ilvH PE=3 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.960e-12
Identity = 35/75 (46.67%), Postives = 54/75 (72.00%), Query Frame = 2
Query:  452 HTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISKLMQQLYKLIDLHEVRDLT 676
            HT+++LV + PGVL  V G+F RRG+NI+SL VG  E + LSR+T VV   D+ + ++++QL KLI+  +V ++T
Sbjct:    3 HTIAVLVENKPGVLARVAGLFRRRGFNIESLTVGTTERDDLSRMTIVVEGDDKVVEQVIKQLNKLIETIKVSEIT 77          

HSP 2 Score: 68.1662 bits (165), Expect = 4.828e-11
Identity = 36/69 (52.17%), Postives = 50/69 (72.46%), Query Frame = 2
Query:    5 LIKVNADPKFRAEIRWLVDIFRAKIVDISEYSLTIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRR 211
            LI+V+A P+ R EI  L +IFRA+IVD+S  S  IEVTGD  K+ A    + ++GI+E+ARTGK+A+ R
Sbjct:   87 LIRVHAPPEKRGEIVELTNIFRARIVDVSRDSFIIEVTGDEDKVSAFIDLMRQYGIKELARTGKVAMVR 155          
BLAST of FC931308 vs. ExPASy Swiss-Prot
Match: ILVH_MYCTU (Acetolactate synthase small subunit OS=Mycobacterium tuberculosis GN=ilvH PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.560e-12
Identity = 36/73 (49.32%), Postives = 53/73 (72.60%), Query Frame = 2
Query:  446 RSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISKLMQQLYKLIDLHEV 664
            ++HTLS+LV D PGVL  V  +F+RRG+NI+SLAVG  E +  SR+T VV A D  + ++ +QL KLI++ ++
Sbjct:    4 KTHTLSVLVEDKPGVLARVAALFSRRGFNIESLAVGATECKDRSRMTIVVSAEDTPLEQITKQLNKLINVIKI 76          

HSP 2 Score: 69.3218 bits (168), Expect = 2.167e-11
Identity = 35/73 (47.95%), Postives = 51/73 (69.86%), Query Frame = 2
Query:    5 LIKVNADPKFRAEIRWLVDIFRAKIVDISEYSLTIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRREKLG 223
            LIKV AD   R+++   V++FRA ++D+S  SLT+E TG+ GK+ A+ R L  FGIREIA++G ++L R   G
Sbjct:   91 LIKVQADAGSRSQVIEAVNLFRANVIDVSPESLTVEATGNRGKLEALLRVLEPFGIREIAQSGMVSLSRGPRG 163          
The following BLAST results are available for this feature:
BLAST of FC931308 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 14
Match NameE-valueIdentityDescription
ILVH_GUITH2.391e-1856.41Acetolactate synthase small subunit OS=Guillardia ... [more]
ILVH_SYNY36.955e-1864.79Acetolactate synthase small subunit OS=Synechocyst... [more]
ILVH_CYACA1.186e-1753.85Acetolactate synthase small subunit OS=Cyanidium c... [more]
ILVH_PORYE4.508e-1755.13Acetolactate synthase small subunit OS=Porphyra ye... [more]
ILVH_PORPU4.508e-1755.13Acetolactate synthase small subunit OS=Porphyra pu... [more]
ILVH_GALSU4.985e-1650.00Acetolactate synthase small subunit OS=Galdieria s... [more]
ILVH_MYCLE1.773e-1350.67Acetolactate synthase small subunit OS=Mycobacteri... [more]
ILVH_METTH6.737e-1345.33Probable acetolactate synthase small subunit OS=Me... [more]
ILVH_ARCFU1.960e-1246.67Probable acetolactate synthase small subunit OS=Ar... [more]
ILVH_MYCTU2.560e-1249.32Acetolactate synthase small subunit OS=Mycobacteri... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G03EF PostHarvP1 Citrus clementina cDNA clone C34103G03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931308 ID=FC931308|Name=FC931308|organism=Citrus clementina|type=EST|length=693bp
AATGCTCATAAAAGTGAATGCAGATCCAAAGTTCCGTGCTGAGATCAGGT
GGTTAGTGGACATATTTAGAGCGAAAATTGTGGATATCTCAGAATACTCT
CTGACAATTGAGGTAACTGGAGATCCGGGGAAGATGGTTGCTGTTCAAAG
GAACTTAAGCAAGTTTGGGATCAGAGAAATTGCGAGAACTGGAAAGATTG
CTTTGAGAAGGGAAAAGTTGGGTGCTTCTGCTCCATTTTGGCGATTTTCA
GCAGCTTCATATCCAGATCTTAATGAAACGCCTACTATTGACGGTCTCGT
TGGGGCAGGACATAGACCACTTCTCAGTGAAACTGATACCGTAGAGGGAG
ATGTTTATCCGGTTGAACCATCTGATGGCTTGACTGTAAATCAAGTTCTT
GATCCGCACTGGGGTGTTCTAAATGATGATGATACAAGTGGACTTCGATC
ACATACTTTATCCATGCTTGTGAATGACTCTCCAGGAGTTCTTAACATTG
TTACAGGGGTTTTTGCTCGAAGGGGCTATAACATTCAGAGTTTGGCTGTT
GGACATGCAGAAACTGAGGGGCTCTCACGAATTACAACAGTTGTTCCCGC
TACAGATGAATCAATTAGCAAGTTGATGCAGCAACTTTATAAGCTAATAG
ATCTACATGAGGTTCGGGATCTTACTCATTTGCCATTTGCTGA
back to top