FC931309

Overview
NameFC931309
Unique NameFC931309
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length715
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931309 vs. ExPASy Swiss-Prot
Match: IDHP_MEDSA (Isocitrate dehydrogenase [NADP], chloroplastic (Fragment) OS=Medicago sativa PE=2 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 1.351e-72
Identity = 129/170 (75.88%), Postives = 147/170 (86.47%), Query Frame = 3
Query:  225 QLAPAMSFRCF-------ASATGIDRVKVQNPIVEMDGDEMTRIIWQMIKDKLIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAIKCATITPDETRMKEFGLKSMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAFGDQYRATDTVIK 713
            Q +P +SF  F        +  G  ++KV NPIVEMDGDEMTRIIW+ IKDKLIFP+++LDIKY+DLG+  RD T+DKVTVESAEATLKYNVAIKCATITPDE R+KEFGLKSMWRSPNGTIRNILNGTVFREPI+C+NIPR++PGW KPICIGRHAFGDQYRATD+VIK
Sbjct:    1 QFSPNLSFSAFFPIITFTTATMGFQKIKVANPIVEMDGDEMTRIIWKYIKDKLIFPFVELDIKYFDLGLPYRDETNDKVTVESAEATLKYNVAIKCATITPDEARVKEFGLKSMWRSPNGTIRNILNGTVFREPIICKNIPRLIPGWTKPICIGRHAFGDQYRATDSVIK 170          
BLAST of FC931309 vs. ExPASy Swiss-Prot
Match: IDHC_TOBAC (Isocitrate dehydrogenase [NADP] OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 2.548e-71
Identity = 124/146 (84.93%), Postives = 139/146 (95.21%), Query Frame = 3
Query:  276 DRVKVQNPIVEMDGDEMTRIIWQMIKDKLIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAIKCATITPDETRMKEFGLKSMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAFGDQYRATDTVIK 713
            D++KV+NPIVEMDGDEMTR+IW+ IKDKLI P+L+LDIKY+DLG+ +RDATDDKVTVESAEAT KYNVAIKCATITPDE R+KEF LKSMWRSPNGTIRNILNGTVFREPI+C+NIPR+VPGW KPICIGRHAFGDQYRATDTVI+
Sbjct:    4 DKIKVENPIVEMDGDEMTRVIWKSIKDKLICPFLELDIKYFDLGLPHRDATDDKVTVESAEATQKYNVAIKCATITPDEARVKEFNLKSMWRSPNGTIRNILNGTVFREPIMCKNIPRLVPGWTKPICIGRHAFGDQYRATDTVIQ 149          
BLAST of FC931309 vs. ExPASy Swiss-Prot
Match: IDHC_SOYBN (Isocitrate dehydrogenase [NADP] OS=Glycine max GN=IDH1 PE=2 SV=2)

HSP 1 Score: 266.544 bits (680), Expect = 9.683e-71
Identity = 124/145 (85.52%), Postives = 136/145 (93.79%), Query Frame = 3
Query:  279 RVKVQNPIVEMDGDEMTRIIWQMIKDKLIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAIKCATITPDETRMKEFGLKSMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAFGDQYRATDTVIK 713
            ++KV NPIVEMDGDEMTR+IW+ IKDKLI P+L+LDIKYYDLG+  RD TDDKVT+ESAEATLKYNVAIKCATITPDE R+KEFGLKSMW+SPNGTIRNILNGTVFREPILC+NIPR+VPGW K ICIGRHAFGDQYRATDTVIK
Sbjct:    6 KIKVANPIVEMDGDEMTRVIWKSIKDKLILPFLELDIKYYDLGLPYRDETDDKVTIESAEATLKYNVAIKCATITPDEARVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKNIPRLVPGWTKAICIGRHAFGDQYRATDTVIK 150          
BLAST of FC931309 vs. ExPASy Swiss-Prot
Match: IDHC_SOLTU (Isocitrate dehydrogenase [NADP] OS=Solanum tuberosum GN=ICDH-1 PE=2 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 2.817e-70
Identity = 123/145 (84.83%), Postives = 136/145 (93.79%), Query Frame = 3
Query:  279 RVKVQNPIVEMDGDEMTRIIWQMIKDKLIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAIKCATITPDETRMKEFGLKSMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAFGDQYRATDTVIK 713
            ++ VQNPIVEMDGDEMTR+IW+ IKDKLI P+L+LDIKY+ LG+ +RDATDDKVTVESAEAT KYNVAIKCATITPDE R+KEF LKSMWRSPNGTIRNILNGTVFREPI+C+NIPR+VPGW KPICIGRHAFGDQYRATDTVIK
Sbjct:    5 KITVQNPIVEMDGDEMTRVIWKSIKDKLILPFLELDIKYFSLGLPHRDATDDKVTVESAEATQKYNVAIKCATITPDEARVKEFNLKSMWRSPNGTIRNILNGTVFREPIMCKNIPRLVPGWTKPICIGRHAFGDQYRATDTVIK 149          
BLAST of FC931309 vs. ExPASy Swiss-Prot
Match: IDH2_CANTR (Isocitrate dehydrogenase [NADP] peroxisomal OS=Candida tropicalis GN=IDP2 PE=1 SV=3)

HSP 1 Score: 235.728 bits (600), Expect = 1.830e-61
Identity = 108/146 (73.97%), Postives = 125/146 (85.62%), Query Frame = 3
Query:  273 IDRVKVQNPIVEMDGDEMTRIIWQMIKDKLIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAIKCATITPDETRMKEFGLKSMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAFGDQYRATDTVI 710
            I ++ V+NPIVEMDGDEMTRIIWQ IKDKLI PYL++D+KYYDLGI  RD TDDKVT ++AEA L+Y V +KCATITPDE R+KEF LK MW SPNGT+RN++ GTVFREPI+  NIPRIVP W+KPI IGRHAFGDQY+ATD VI
Sbjct:    4 IQKITVKNPIVEMDGDEMTRIIWQFIKDKLILPYLNVDLKYYDLGIEYRDKTDDKVTTDAAEAILQYGVGVKCATITPDEARVKEFNLKKMWLSPNGTLRNVIGGTVFREPIVIDNIPRIVPSWEKPIIIGRHAFGDQYKATDVVI 149          
BLAST of FC931309 vs. ExPASy Swiss-Prot
Match: IDHP_ASPNG (Isocitrate dehydrogenase [NADP], mitochondrial OS=Aspergillus niger GN=icdA PE=2 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 2.390e-61
Identity = 110/149 (73.83%), Postives = 127/149 (85.23%), Query Frame = 3
Query:  264 ATGIDRVKVQNPIVEMDGDEMTRIIWQMIKDKLIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAIKCATITPDETRMKEFGLKSMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAFGDQYRATDTVI 710
            AT I ++KV+NP+VE+DGDEMTRIIWQ I++KLI PYLD+D+KYYDLG+  RD TDD+VTVE+AEA  KY V +KCATITPDE R++EF LK MW SPNGTIRNIL GTVFREPI+   IPR+VPGW KPI IGRHAFGDQYRATD VI
Sbjct:   87 ATEIPKIKVKNPVVELDGDEMTRIIWQEIREKLILPYLDVDLKYYDLGLEYRDQTDDQVTVEAAEAIKKYGVGVKCATITPDEARVEEFKLKKMWLSPNGTIRNILGGTVFREPIIIPAIPRLVPGWNKPIIIGRHAFGDQYRATDRVI 235          
BLAST of FC931309 vs. ExPASy Swiss-Prot
Match: IDH1_CANTR (Isocitrate dehydrogenase [NADP], mitochondrial OS=Candida tropicalis GN=IDP1 PE=3 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 5.325e-61
Identity = 108/150 (72.00%), Postives = 129/150 (86.00%), Query Frame = 3
Query:  261 SATGIDRVKVQNPIVEMDGDEMTRIIWQMIKDKLIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAIKCATITPDETRMKEFGLKSMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAFGDQYRATDTVI 710
            SAT  D++KV+NPIVE+DGDEMTRIIWQ IKD+LI PYLD+D+KYYDLGI +RDATDD++T+++A A  +Y V +KCATITPDE R+KEF LK MW SPNGTIRNIL GTVFRE I+   IPR++PGW+KPI IGRHAFGDQY+ATD VI
Sbjct:   23 SATLADKIKVKNPIVELDGDEMTRIIWQKIKDQLILPYLDVDLKYYDLGIESRDATDDQITIDAANAIKEYGVGVKCATITPDEARVKEFHLKKMWLSPNGTIRNILGGTVFRESIIIPCIPRLIPGWEKPIVIGRHAFGDQYKATDLVI 172          
BLAST of FC931309 vs. ExPASy Swiss-Prot
Match: IDHP_RAT (Isocitrate dehydrogenase [NADP], mitochondrial OS=Rattus norvegicus GN=Idh2 PE=1 SV=2)

HSP 1 Score: 233.032 bits (593), Expect = 1.186e-60
Identity = 104/144 (72.22%), Postives = 128/144 (88.89%), Query Frame = 3
Query:  279 RVKVQNPIVEMDGDEMTRIIWQMIKDKLIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAIKCATITPDETRMKEFGLKSMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAFGDQYRATDTVI 710
            R+KV+ P+VEMDGDEMTRIIWQ IK+KLI P++D+ +KY+DLG+ NRD T+D+VT++SA AT KY+VA+KCATITPDE R++EF LK MW+SPNGTIRNIL GTVFREPI+C+NIPR+VPGW KPI IGRHA GDQY+ATD V+
Sbjct:   43 RIKVEKPVVEMDGDEMTRIIWQFIKEKLILPHVDVQLKYFDLGLPNRDQTNDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVV 186          
BLAST of FC931309 vs. ExPASy Swiss-Prot
Match: IDHP_MOUSE (Isocitrate dehydrogenase [NADP], mitochondrial OS=Mus musculus GN=Idh2 PE=1 SV=3)

HSP 1 Score: 233.032 bits (593), Expect = 1.186e-60
Identity = 104/144 (72.22%), Postives = 128/144 (88.89%), Query Frame = 3
Query:  279 RVKVQNPIVEMDGDEMTRIIWQMIKDKLIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAIKCATITPDETRMKEFGLKSMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAFGDQYRATDTVI 710
            R+KV+ P+VEMDGDEMTRIIWQ IK+KLI P++D+ +KY+DLG+ NRD T+D+VT++SA AT KY+VA+KCATITPDE R++EF LK MW+SPNGTIRNIL GTVFREPI+C+NIPR+VPGW KPI IGRHA GDQY+ATD V+
Sbjct:   43 RIKVEKPVVEMDGDEMTRIIWQFIKEKLILPHVDVQLKYFDLGLPNRDQTNDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVV 186          
BLAST of FC931309 vs. ExPASy Swiss-Prot
Match: IDHP_MACFA (Isocitrate dehydrogenase [NADP], mitochondrial OS=Macaca fascicularis GN=IDH2 PE=2 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 1.186e-60
Identity = 105/143 (73.43%), Postives = 126/143 (88.11%), Query Frame = 3
Query:  279 RVKVQNPIVEMDGDEMTRIIWQMIKDKLIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAIKCATITPDETRMKEFGLKSMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAFGDQYRATDTV 707
            R+KV  P+VEMDGDEMTRIIWQ IK+KLI P++D+ +KY+DLG+ NRD TDD+VT++SA AT KY+VA+KCATITPDE R++EF LK MW+SPNGTIRNIL GTVFREPI+C+NIPR+VPGW KPI IGRHA GDQY+ATD V
Sbjct:   43 RIKVAKPVVEMDGDEMTRIIWQFIKEKLILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFV 185          
The following BLAST results are available for this feature:
BLAST of FC931309 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 30
Match NameE-valueIdentityDescription
IDHP_MEDSA1.351e-7275.88Isocitrate dehydrogenase [NADP], chloroplastic (Fr... [more]
IDHC_TOBAC2.548e-7184.93Isocitrate dehydrogenase [NADP] OS=Nicotiana tabac... [more]
IDHC_SOYBN9.683e-7185.52Isocitrate dehydrogenase [NADP] OS=Glycine max GN=... [more]
IDHC_SOLTU2.817e-7084.83Isocitrate dehydrogenase [NADP] OS=Solanum tuberos... [more]
IDH2_CANTR1.830e-6173.97Isocitrate dehydrogenase [NADP] peroxisomal OS=Can... [more]
IDHP_ASPNG2.390e-6173.83Isocitrate dehydrogenase [NADP], mitochondrial OS=... [more]
IDH1_CANTR5.325e-6172.00Isocitrate dehydrogenase [NADP], mitochondrial OS=... [more]
IDHP_RAT1.186e-6072.22Isocitrate dehydrogenase [NADP], mitochondrial OS=... [more]
IDHP_MOUSE1.186e-6072.22Isocitrate dehydrogenase [NADP], mitochondrial OS=... [more]
IDHP_MACFA1.186e-6073.43Isocitrate dehydrogenase [NADP], mitochondrial OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G04EF PostHarvP1 Citrus clementina cDNA clone C34103G04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931309 ID=FC931309|Name=FC931309|organism=Citrus clementina|type=EST|length=715bp
GACGGCGTCTTAATTTAAACGCCTATTATCATTCCCAAATGCTCAGGCTC
ATCAATAGTAGTTGTGGCAGTTTACGATCAAGCGTCATGTCATCTGCTGC
TGCCACCACCAAAATGATGTCATCGTCAACCGTCGCCGTTAAAAACCCCA
GATGGTCACTCTCTTCTTCAAACAATTCCGGTTTATTCAGCGGATATGTG
AACAATCGTGTGTCGTTTCGGAACCAGCTGGCTCCTGCGATGTCGTTTCG
GTGTTTTGCTAGTGCCACGGGGATTGATAGAGTCAAGGTTCAGAATCCTA
TCGTTGAAATGGACGGCGATGAGATGACGAGGATTATTTGGCAGATGATA
AAAGACAAACTCATTTTTCCTTACTTAGATTTGGATATAAAGTATTATGA
CTTGGGGATATTGAATCGTGATGCAACTGATGACAAGGTTACCGTAGAAA
GCGCTGAAGCAACTCTAAAGTACAATGTTGCCATCAAATGTGCCACAATA
ACTCCTGATGAGACCAGAATGAAGGAGTTTGGGCTGAAGTCAATGTGGAG
AAGTCCCAATGGCACAATTAGAAACATTTTAAATGGTACTGTTTTCCGTG
AACCCATCCTATGCCAGAATATTCCTAGAATAGTTCCTGGTTGGAAGAAA
CCTATATGTATTGGTAGGCATGCCTTTGGTGATCAGTATCGTGCTACTGA
TACAGTCATTAAGGG
back to top