FC931311

Overview
NameFC931311
Unique NameFC931311
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length638
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig4548 contig Ccv1_Contig4548:40..677. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931311 vs. ExPASy Swiss-Prot
Match: PER52_ARATH (Peroxidase 52 OS=Arabidopsis thaliana GN=PER52 PE=2 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 3.024e-62
Identity = 118/197 (59.90%), Postives = 146/197 (74.11%), Query Frame = 1
Query:   61 VTLILTIISLLACTST-----AQLSPTFYATSCPNFQRIARDEMTKAVNRQPRNAASILRLFFHDCFVNGCDGSVLLDDTATFTGEKNAGPNRNSARGFEVIDAIKTRLEAACNATVSCADILAVAARDGVALLGGPTWTVPLGRRDARTASQSAANSQIPGPSSSLATLISMFAAKGLTAQDMTVLSGGHAIGFAR 636
            +++++ +++LL          AQL+  FY+TSCPN     +  +  AVN + R  ASILRLFFHDCFVNGCDGS+LLDDT++FTGE+NA PNRNSARGF VID IK+ +E AC   VSCADILA+AARD V  LGGP W V +GRRDARTASQ+AANS IP P+SSL+ LIS F+A GL+ +DM  LSG H IG +R
Sbjct:    7 ISILVLVVTLLLQGDNNYVVEAQLTTNFYSTSCPNLLSTVQTAVKSAVNSEARMGASILRLFFHDCFVNGCDGSILLDDTSSFTGEQNAAPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNVKVGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSR 203          
BLAST of FC931311 vs. ExPASy Swiss-Prot
Match: PERP7_BRARA (Peroxidase P7 OS=Brassica rapa PE=1 SV=3)

HSP 1 Score: 236.498 bits (602), Expect = 8.797e-62
Identity = 115/175 (65.71%), Postives = 136/175 (77.71%), Query Frame = 1
Query:  112 QLSPTFYATSCPNFQRIARDEMTKAVNRQPRNAASILRLFFHDCFVNGCDGSVLLDDTATFTGEKNAGPNRNSARGFEVIDAIKTRLEAACNATVSCADILAVAARDGVALLGGPTWTVPLGRRDARTASQSAANSQIPGPSSSLATLISMFAAKGLTAQDMTVLSGGHAIGFAR 636
            QL+  FY+TSCPN     +  +  AV+ QPR  ASILRLFFHDCFVNGCDGS+LLDDT++FTGE+NAGPNRNSARGF VI+ IK+ +E AC   VSCADILA+AARD V  LGGP W V +GRRDA+TASQ+AANS IP PS SL+ LIS F+A GL+ +DM  LSG H IG +R
Sbjct:    1 QLTTNFYSTSCPNLLSTVKSGVKSAVSSQPRMGASILRLFFHDCFVNGCDGSILLDDTSSFTGEQNAGPNRNSARGFTVINDIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNVKVGRRDAKTASQAAANSNIPAPSMSLSQLISSFSAVGLSTRDMVALSGAHTIGQSR 175          
BLAST of FC931311 vs. ExPASy Swiss-Prot
Match: PER4_VITVI (Peroxidase 4 OS=Vitis vinifera GN=GSVIVT00023967001 PE=1 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 4.086e-59
Identity = 114/201 (56.72%), Postives = 148/201 (73.63%), Query Frame = 1
Query:   34 MASSISYLFVTLILTIISLLACTSTAQLSPTFYATSCPNFQRIARDEMTKAVNRQPRNAASILRLFFHDCFVNGCDGSVLLDDTATFTGEKNAGPNRNSARGFEVIDAIKTRLEAACNATVSCADILAVAARDGVALLGGPTWTVPLGRRDARTASQSAANSQIPGPSSSLATLISMFAAKGLTAQDMTVLSGGHAIGFAR 636
            MASS S+  V + L +++L A +S+AQLS  FY+ +CP      +  +  AV+++ R  AS+LRLFFHDCFVNGCD SVLLDDT++FTGE+ A PN+NS RG  VID IK+++E+ C   VSCADI+A+AARD V +LGGP W V LGRRD++TAS S AN+ IP P+SSL+ LIS F A+GL+ +DM  LSG H IG AR
Sbjct:    1 MASS-SFSIVVVALGVLALFAGSSSAQLSTNFYSKTCPKVFDTVKSGVQSAVSKERRMGASLLRLFFHDCFVNGCDASVLLDDTSSFTGEQTAVPNKNSIRGLNVIDNIKSQVESVCPGVVSCADIIAIAARDSVVILGGPDWDVKLGRRDSKTASLSGANNNIPPPTSSLSNLISKFQAQGLSTRDMVALSGAHTIGQAR 200          
BLAST of FC931311 vs. ExPASy Swiss-Prot
Match: PER9_ARATH (Peroxidase 9 OS=Arabidopsis thaliana GN=PER9 PE=1 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 1.898e-56
Identity = 104/176 (59.09%), Postives = 128/176 (72.73%), Query Frame = 1
Query:  109 AQLSPTFYATSCPNFQRIARDEMTKAVNRQPRNAASILRLFFHDCFVNGCDGSVLLDDTATFTGEKNAGPNRNSARGFEVIDAIKTRLEAACNATVSCADILAVAARDGVALLGGPTWTVPLGRRDARTASQSAANSQIPGPSSSLATLISMFAAKGLTAQDMTVLSGGHAIGFAR 636
            + L P FY  SCP    I    + KA+ ++PR AAS+LRL FHDCFV GCD S+LLDD+AT   EKNAGPN+NS RGF+VID IK +LE AC  TVSCADILA+AAR    L GGP+W +PLGRRD+RTAS + AN+ IP P+S++  L++MF  KGL  +D+  LSGGH IG AR
Sbjct:   43 SNLYPQFYQFSCPQADEIVMTVLEKAIAKEPRMAASLLRLHFHDCFVQGCDASILLDDSATIRSEKNAGPNKNSVRGFQVIDEIKAKLEQACPQTVSCADILALAARGSTILSGGPSWELPLGRRDSRTASLNGANTNIPAPNSTIQNLLTMFQRKGLNEEDLVSLSGGHTIGVAR 218          
BLAST of FC931311 vs. ExPASy Swiss-Prot
Match: PER2_ORYSJ (Peroxidase 2 OS=Oryza sativa subsp. japonica GN=PRX112 PE=2 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 3.238e-56
Identity = 115/201 (57.21%), Postives = 141/201 (70.15%), Query Frame = 1
Query:   34 MASSISYLFVTLILTIISLLACTSTAQLSPTFYATSCPNFQRIARDEMTKAVNRQPRNAASILRLFFHDCFVNGCDGSVLLDDTATFTGEKNAGPNRNSARGFEVIDAIKTRLEAACNATVSCADILAVAARDGVALLGGPTWTVPLGRRDARTASQSAANSQIPGPSSSLATLISMFAAKGLTAQDMTVLSGGHAIGFAR 636
            MAS+ S   V+L+L + + +A  ++AQLS TFY TSCPN     +  +T AVN +PR  AS++RL FHDCFV GCD SVLL        E+NAGPN  S RGF V+D IKT++EA C+ TVSCADILAVAARD V  LGGP+WTV LGRRD+ TA++S AN+ +P PSSSLA LI  F+ KGL   DM  LSG H IG A+
Sbjct:    1 MASASS---VSLMLLVAAAMASAASAQLSATFYDTSCPNALSTIKSAVTAAVNSEPRMGASLVRLHFHDCFVQGCDASVLLSGQ-----EQNAGPNAGSLRGFNVVDNIKTQVEAICSQTVSCADILAVAARDSVVALGGPSWTVLLGRRDSTTANESQANTDLPAPSSSLAELIGNFSRKGLDVTDMVALSGAHTIGQAQ 193          
BLAST of FC931311 vs. ExPASy Swiss-Prot
Match: PER2_ORYSI (Peroxidase 2 OS=Oryza sativa subsp. indica GN=PRX112 PE=3 SV=2)

HSP 1 Score: 218.009 bits (554), Expect = 3.238e-56
Identity = 115/201 (57.21%), Postives = 141/201 (70.15%), Query Frame = 1
Query:   34 MASSISYLFVTLILTIISLLACTSTAQLSPTFYATSCPNFQRIARDEMTKAVNRQPRNAASILRLFFHDCFVNGCDGSVLLDDTATFTGEKNAGPNRNSARGFEVIDAIKTRLEAACNATVSCADILAVAARDGVALLGGPTWTVPLGRRDARTASQSAANSQIPGPSSSLATLISMFAAKGLTAQDMTVLSGGHAIGFAR 636
            MAS+ S   V+L+L + + +A  ++AQLS TFY TSCPN     +  +T AVN +PR  AS++RL FHDCFV GCD SVLL        E+NAGPN  S RGF V+D IKT++EA C+ TVSCADILAVAARD V  LGGP+WTV LGRRD+ TA++S AN+ +P PSSSLA LI  F+ KGL   DM  LSG H IG A+
Sbjct:    1 MASASS---VSLMLLVAAAMASAASAQLSATFYDTSCPNALSTIKSAVTAAVNSEPRMGASLVRLHFHDCFVQGCDASVLLSGQ-----EQNAGPNAGSLRGFNVVDNIKTQVEAICSQTVSCADILAVAARDSVVALGGPSWTVLLGRRDSTTANESQANTDLPAPSSSLAELIGNFSRKGLDVTDMVALSGAHTIGQAQ 193          
BLAST of FC931311 vs. ExPASy Swiss-Prot
Match: PER67_ARATH (Peroxidase 67 OS=Arabidopsis thaliana GN=PER67 PE=2 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 4.229e-56
Identity = 110/191 (57.59%), Postives = 140/191 (73.30%), Query Frame = 1
Query:   67 LILTIISLLACTSTAQLSPTFYATSCPNFQRIARDEMTKAVNRQPRNAASILRLFFHDCFVNGCDGSVLLDDTATFTGEKNAGPNRNSARGFEVIDAIKTRLEAACNATVSCADILAVAARDGVALLGGPTWTVPLGRRDARTASQSAANS-QIPGPSSSLATLISMFAAKGLTAQDMTVLSGGHAIGFAR 636
            ++L +I +LA  S AQL+  FY  SCP+   + R  + +AV R+PR  AS+LRLFFHDCFVNGCDGS+LLDDT +F GEK +GP+ NS RGFEVID IK ++E  C   VSCADILA+ ARD V LLGGP W+V LGRRD+ TA+ +AANS  IP P ++L+ LI+ F A+GL+ +DM  LSG H IG A+
Sbjct:    5 VLLMMIMMLASQSEAQLNRDFYKESCPSLFLVVRRVVKRAVAREPRMGASLLRLFFHDCFVNGCDGSLLLDDTPSFLGEKTSGPSNNSVRGFEVIDKIKFKVEKMCPGIVSCADILAITARDSVLLLGGPGWSVKLGRRDSTTANFAAANSGVIPPPITTLSNLINRFKAQGLSTRDMVALSGAHTIGRAQ 195          
BLAST of FC931311 vs. ExPASy Swiss-Prot
Match: PER70_MAIZE (Peroxidase 70 OS=Zea mays GN=PER70 PE=1 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 4.676e-55
Identity = 111/201 (55.22%), Postives = 139/201 (69.15%), Query Frame = 1
Query:   34 MASSISYLFVTLILTIISLLACTSTAQLSPTFYATSCPNFQRIARDEMTKAVNRQPRNAASILRLFFHDCFVNGCDGSVLLDDTATFTGEKNAGPNRNSARGFEVIDAIKTRLEAACNATVSCADILAVAARDGVALLGGPTWTVPLGRRDARTASQSAANSQIPGPSSSLATLISMFAAKGLTAQDMTVLSGGHAIGFAR 636
            MASS S+  +++++ +    A  ++AQLSPTFY+ SCP      +  +T AV ++ R  AS+LRL FHDCFV GCDGSVLL+DTATFTGE+ A PN  S RGF V+D IK ++EA C   VSCADILAVAARD V  LGGP+W V LGRRD+ TAS + ANS +P PS  LA L + FA K L+  D+  LSG H IG A+
Sbjct:    1 MASS-SFTSLSVMVLLCLAAAAVASAQLSPTFYSRSCPRALATIKAAVTAAVAQEARMGASLLRLHFHDCFVQGCDGSVLLNDTATFTGEQTANPNVGSIRGFGVVDNIKAQVEAVCPGVVSCADILAVAARDSVVALGGPSWRVLLGRRDSTTASLALANSDLPAPSLDLANLTAAFAKKRLSRTDLVALSGAHTIGLAQ 200          
BLAST of FC931311 vs. ExPASy Swiss-Prot
Match: PER1_ARAHY (Cationic peroxidase 1 OS=Arachis hypogaea GN=PNC1 PE=1 SV=2)

HSP 1 Score: 214.157 bits (544), Expect = 4.676e-55
Identity = 111/201 (55.22%), Postives = 137/201 (68.16%), Query Frame = 1
Query:   34 MASSISYLFVTLILTIISLLACTSTAQLSPTFYATSCPNFQRIARDEMTKAVNRQPRNAASILRLFFHDCFVNGCDGSVLLDDTATFTGEKNAGPNRNSARGFEVIDAIKTRLEAACNATVSCADILAVAARDGVALLGGPTWTVPLGRRDARTASQSAANSQIPGPSSSLATLISMFAAKGLTAQDMTVLSGGHAIGFAR 636
            MA  IS +   + + +I L     +AQLS  FYAT CPN     +  +  AV ++ R  AS+LRL FHDCFV GCD SVLLDDT+ FTGEK AGPN NS RGFEVID IK+++E+ C   VSCADILAVAARD V  LGG +W V LGRRD+ TAS S+ANS +P P  +L+ LIS F+ KG T +++  LSG H IG A+
Sbjct:    1 MALPISKVDFLIFMCLIGL----GSAQLSSNFYATKCPNALSTIKSAVNSAVAKEARMGASLLRLHFHDCFVQGCDASVLLDDTSNFTGEKTAGPNANSIRGFEVIDTIKSQVESLCPGVVSCADILAVAARDSVVALGGASWNVLLGRRDSTTASLSSANSDLPAPFFNLSGLISAFSNKGFTTKELVTLSGAHTIGQAQ 197          
BLAST of FC931311 vs. ExPASy Swiss-Prot
Match: PER68_ARATH (Peroxidase 68 OS=Arabidopsis thaliana GN=PER68 PE=2 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 2.320e-54
Identity = 108/191 (56.54%), Postives = 135/191 (70.68%), Query Frame = 1
Query:   67 LILTIISLLACTSTAQLSPTFYATSCPNFQRIARDEMTKAVNRQPRNAASILRLFFHDCFVNGCDGSVLLDDTATFTGEKNAGPNRNSARGFEVIDAIKTRLEAACNATVSCADILAVAARDGVALLGGPTWTVPLGRRDARTASQSAANSQI-PGPSSSLATLISMFAAKGLTAQDMTVLSGGHAIGFAR 636
            ++L  I +L   + AQL   FY+ SCP+     R  + + V ++ R AAS+LRLFFHDCFVNGCD S+LLDDT +F GEK AGPN NS RG+EVIDAIK+R+E  C   VSCADILA+ ARD V L+GG  W+V LGRRD+ TAS S ANS + P P+S+L  LI++F A GL+ +DM  LSG H IG AR
Sbjct:   14 VVLLFIVMLGSQAQAQLRTDFYSDSCPSLLPTVRRVVQREVAKERRIAASLLRLFFHDCFVNGCDASILLDDTRSFLGEKTAGPNNNSVRGYEVIDAIKSRVERLCPGVVSCADILAITARDSVLLMGGRGWSVKLGRRDSITASFSTANSGVLPPPTSTLDNLINLFRANGLSPRDMVALSGAHTIGQAR 204          
The following BLAST results are available for this feature:
BLAST of FC931311 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 109
Match NameE-valueIdentityDescription
PER52_ARATH3.024e-6259.90Peroxidase 52 OS=Arabidopsis thaliana GN=PER52 PE=... [more]
PERP7_BRARA8.797e-6265.71Peroxidase P7 OS=Brassica rapa PE=1 SV=3[more]
PER4_VITVI4.086e-5956.72Peroxidase 4 OS=Vitis vinifera GN=GSVIVT0002396700... [more]
PER9_ARATH1.898e-5659.09Peroxidase 9 OS=Arabidopsis thaliana GN=PER9 PE=1 ... [more]
PER2_ORYSJ3.238e-5657.21Peroxidase 2 OS=Oryza sativa subsp. japonica GN=PR... [more]
PER2_ORYSI3.238e-5657.21Peroxidase 2 OS=Oryza sativa subsp. indica GN=PRX1... [more]
PER67_ARATH4.229e-5657.59Peroxidase 67 OS=Arabidopsis thaliana GN=PER67 PE=... [more]
PER70_MAIZE4.676e-5555.22Peroxidase 70 OS=Zea mays GN=PER70 PE=1 SV=1[more]
PER1_ARAHY4.676e-5555.22Cationic peroxidase 1 OS=Arachis hypogaea GN=PNC1 ... [more]
PER68_ARATH2.320e-5456.54Peroxidase 68 OS=Arabidopsis thaliana GN=PER68 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G06EF PostHarvP1 Citrus clementina cDNA clone C34103G06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931311 ID=FC931311|Name=FC931311|organism=Citrus clementina|type=EST|length=638bp
ATCTGCTTTAACTTTCCATTTTTGGATTGGTTCATGGCATCTTCAATTTC
TTATTTGTTTGTTACACTTATACTCACAATTATATCCCTTCTAGCTTGCA
CCTCCACTGCGCAACTTTCTCCAACCTTTTATGCAACATCTTGCCCCAAT
TTTCAAAGAATCGCGAGGGATGAAATGACCAAAGCTGTTAATAGACAACC
GCGTAATGCTGCCTCTATTCTTCGCCTCTTCTTCCATGACTGCTTCGTTA
ATGGCTGCGATGGGTCGGTACTACTAGATGACACAGCCACATTCACCGGC
GAGAAGAATGCAGGACCAAACAGAAACTCTGCTAGGGGTTTCGAAGTGAT
TGACGCCATTAAAACTCGTCTGGAAGCAGCTTGCAACGCCACCGTTTCAT
GTGCCGACATCCTTGCTGTTGCAGCCCGAGACGGTGTCGCCTTGCTTGGA
GGACCGACTTGGACGGTACCGCTCGGCCGGCGAGATGCAAGAACGGCCAG
TCAGAGTGCAGCCAATAGCCAAATCCCTGGACCATCCTCCAGCCTGGCAA
CACTCATATCAATGTTTGCAGCCAAAGGCCTGACCGCCCAAGACATGACA
GTCCTCTCCGGCGGCCACGCCATCGGATTCGCTCGATG
back to top