FC931313

Overview
NameFC931313
Unique NameFC931313
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length727
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig3496 contig Ccv1_Contig3496:120..848. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C76B1_HELTU (7-ethoxycoumarin O-deethylase OS=Helianthus tuberosus GN=CYP76B1 PE=1 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 6.094e-52
Identity = 104/209 (49.76%), Postives = 142/209 (67.94%), Query Frame = 3
Query:   57 MDMVSCVPWLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDLADPTSKTAREFKQQI 683
            MD +  V  LL S+IL+  L           + LPPGPT  P+IGNL  LG  PH+SLAKLAKIHGPIMSL+ GQ+TT+V SSA  A+E+L+ QD +F  R +PDA+ A+ H    + +L V T WR LR+I +S+ FS+  L+A QHLR KK+++L+AY ++   +   +HIG+AAF T+LNL+SNTIFS DL DP   + +EF++ I
Sbjct:    1 MDFLIIVSTLLLSYILIWVLGV------GKPKNLPPGPTRLPIIGNLHLLGALPHQSLAKLAKIHGPIMSLQLGQITTLVISSATAAEEVLKKQDLAFSTRNVPDAVRAYNHERHSISFLHVCTEWRTLRRIVSSNIFSNSSLEAKQHLRSKKVEELIAYCRKAALSNENVHIGRAAFRTSLNLLSNTIFSKDLTDPYEDSGKEFREVI 203          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C76C4_ARATH (Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=2 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.234e-36
Identity = 84/214 (39.25%), Postives = 130/214 (60.75%), Query Frame = 3
Query:   57 MDMVSCVP-WLLFSWI---LVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATL-WRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDLADPTSKTAREFKQQI 683
            MD++S    +LLF +I    +++    SR     +  LPPGP   P+IGN+ ++G  PH S A LAKI+GPIMSLKFG + +VV +S   A+E+L+  D     R   D+I   GH E  + WLP ++  WR LRK+  +  FS ++ +A + LR KK+Q+L++++ E+     A+ I +A++ T LN+ISN +FS+DL    SK + EF+  +
Sbjct:    1 MDIISGQALFLLFCFISSCFLISTTARSRRSSGRAATLPPGPPRLPIIGNIHQVGKNPHSSFADLAKIYGPIMSLKFGCLNSVVITSPEAAREVLRTHDQILSGRKSNDSIRCFGHEEVSVIWLPPSSARWRMLRKLSVTLMFSPQRTEATKALRMKKVQELVSFMNESSERKEAVDISRASYTTVLNIISNILFSVDLGSYDSKKSNEFQDTV 214          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C76C3_ARATH (Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2)

HSP 1 Score: 150.599 bits (379), Expect = 7.995e-36
Identity = 75/174 (43.10%), Postives = 109/174 (62.64%), Query Frame = 3
Query:  141 SGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDLADPTSKTA 662
            S +  LPPGP   P++GN+ +LG  PH+SLA  +K +GPIMSLK G++T VV SS   AKE L+  D     RT  DA+ A  HH+  + W+P +  WR L+K    +  S + LDA Q LR +K+++L++ V E    G AI + +A+F T+ N+ISN +FS+DLA   S ++
Sbjct:   33 SSTGTLPPGPPILPLVGNIFQLGFNPHRSLAAFSKTYGPIMSLKLGRLTAVVISSPEAAKEALRTHDHVMSARTFNDALRAFDHHKHSIVWIPPSARWRFLKKTITKYLLSPQNLDAIQSLRMRKVEELVSLVNEFRERGEAIDLARASFVTSFNIISNALFSVDLATYDSNSS 206          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C80B1_ESCCA ((S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Eschscholzia californica GN=CYP80B1 PE=2 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 4.387e-34
Identity = 72/192 (37.50%), Postives = 115/192 (59.90%), Query Frame = 3
Query:  141 SGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFS---IDLADPTSKTAREFKQQIGV*WKKLE 707
            SG + LPPGP P+P++GNLL+LG+KPH   A+LA+ +G I +LK G  T VV S+++ A EIL+  D     R +  +    GH E  + W      W+NLRK+C +  F+ + +++  H+R KK ++++ Y+ +  + G  + I +  FGT +N+  N IFS    +L DP S ++ EFK+ +   W+ LE
Sbjct:   23 SGHKNLPPGPKPWPIVGNLLQLGEKPHAQFAELAQTYGDIFTLKMGTETVVVASTSSAASEILKTHDRILSARYVFQSFRVKGHVENSIVWSDCTETWKNLRKVCRTELFTQKMIESQAHVREKKCEEMVEYLMK--KQGEEVKIVEVIFGTLVNIFGNLIFSQNIFELGDPNSGSS-EFKEYL---WRMLE 208          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C80B2_ESCCA ((S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Eschscholzia californica GN=CYP80B2 PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 1.667e-33
Identity = 73/206 (35.44%), Postives = 121/206 (58.74%), Query Frame = 3
Query:   99 ILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFS---IDLADPTSKTAREFKQQIGV*WKKLE 707
            +++ ++ Y   G  SG + LPPGP P+P++GNLL+LG+KPH   A+LA+ +G I +LK G  T VV S+++ A EIL+  D     R +  +    GH E  + W      W+NLRK+C +  F+ + +++  H+R KK ++++ Y+ +  + G  + I +  FGT +N+  N IFS    +L  P S ++ EFK+ +   W+ LE
Sbjct:   11 VIISSILYLLFG-SSGHKNLPPGPKPWPIVGNLLQLGEKPHAQFAELAQTYGDIFTLKMGTETVVVASTSSAASEILKTHDRILSARYVFQSFRVKGHVENSIVWSDCTETWKNLRKVCRTELFTQKMIESQAHVREKKCEEMVEYLMK--KQGEEVKIVEVIFGTLVNIFGNLIFSQNIFELGXPNSGSS-EFKEYL---WRMLE 209          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C76C2_ARATH (Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 1.411e-32
Identity = 74/203 (36.45%), Postives = 123/203 (60.59%), Query Frame = 3
Query:   87 LFSWILVVALNYFSRGFKSGSRRL---PPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWL-PVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDLADPTSKTAREFKQQI 683
            LF ++L   + +F+      SR++   PPGP   P+IGN+  +G  PH S A L+K +GPIMSLKFG + TVV +S   A+E+L+  D    +RT  ++I +  H +  + WL P ++ WR LRK+  +  FS ++++A + LR  K+++L++++ E+     A+ I +A F T LN+ISN +FS+DL +  S  +  F+  +
Sbjct:   12 LFCFVLSFFIIFFTTTRPRSSRKVVPSPPGPPRLPIIGNIHLVGRNPHHSFADLSKTYGPIMSLKFGSLNTVVVTSPEAAREVLRTYDQILSSRTPTNSIRSINHDKVSVVWLPPSSSRWRLLRKLSATQLFSPQRIEATKTLRENKVKELVSFMSESSEREEAVDISRATFITALNIISNILFSVDLGNYDSNKSGVFQDTV 214          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C76C1_ARATH (Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 2.662e-31
Identity = 71/197 (36.04%), Postives = 119/197 (60.41%), Query Frame = 3
Query:   84 LLFSWILVVALNYF---SRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATL-WRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDLADPTSKTA 662
            LLF +IL   L +    S     G+  LPPGP   P+IGN+  +G  PH+S A+L+K +GP+MSLK G + TVV +S   A+E+L+  D     R+  +A+ +  H +  + WLP ++  WR LR++  +   S ++++A + LR  K+++L++++ E+     ++ I + AF TTLN+ISN +FS+DL    +K +
Sbjct:   11 LLFCFILSCFLIFTTTRSGRISRGATALPPGPPRLPIIGNIHLVGKHPHRSFAELSKTYGPVMSLKLGSLNTVVIASPEAAREVLRTHDQILSARSPTNAVRSINHQDASLVWLPSSSARWRLLRRLSVTQLLSPQRIEATKALRMNKVKELVSFISESSDREESVDISRVAFITTLNIISNILFSVDLGSYNAKAS 207          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C76A2_SOLME (Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 1.460e-29
Identity = 65/203 (32.02%), Postives = 113/203 (55.67%), Query Frame = 3
Query:   81 WLLFSWILVVA---LNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRA---GTAIHIGQAAFGTTLNLISNTIFSIDLADPTSKTAREF 671
            ++ FS I+++    L +  +     S + PPGP   P+ GN+ ELG +P+K +A L + +GP++ LK G   T+V  +A  ++E+ +N D SF NR IPD   AH +++  +   P    WR  R+IC    F  +++   + +RRK + ++L ++++   +   G+ I + +  F  + N++ N I S DLAD  S+ A EF
Sbjct:    7 YVFFSAIIILPAFILFFSQKNTTKSSYKFPPGPPGLPIFGNMFELGTEPYKKMAVLRQKYGPVLWLKLGSTYTMVVQTAQASEELFKNHDISFANRVIPDVNQAHSYYQGSLAIAPYGPFWRFQRRICTIEMFVHKKISETEPVRRKCVDNMLKWIEKEANSAEKGSGIEVTRFVFLASFNMLGNLILSKDLADLESEEASEF 209          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: F3PH_PETHY (Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 2.413e-24
Identity = 69/214 (32.24%), Postives = 114/214 (53.27%), Query Frame = 3
Query:   57 MDMVSCVPW-LLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFS----IDLADPTSKTAREFKQQI 683
            M+++S + + ++FS++L   L  F R  K     LPPGP P+P+IGNL+ LG KPH+S A +A+ +GP+M LK G V  VV +SA++A + L+  D +F +R          ++   + + P    WR LRKIC+ H FS++ LD  +H+R+ +++ L   +         + +GQ     T N ++  +       D +      A EFK  +
Sbjct:    1 MEILSLILYTVIFSFLLQFILRSFFR--KRYPLPLPPGPKPWPIIGNLVHLGPKPHQSTAAMAQTYGPLMYLKMGFVDVVVAASASVAAQFLKTHDANFSSRPPNSGAEHMAYNYQDLVFAPYGPRWRMLRKICSVHLFSTKALDDFRHVRQDEVKTLTRALAS--AGQKPVKLGQLLNVCTTNALARVMLGKRVFADGSGDVDPQAAEFKSMV 210          
BLAST of FC931313 vs. ExPASy Swiss-Prot
Match: C71BC_ARATH (Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=CYP71B12 PE=2 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.564e-23
Identity = 58/188 (30.85%), Postives = 108/188 (57.45%), Query Frame = 3
Query:   96 WILVVALNYFS-----RGFKSGSRRLPPGPTPYPVIGNLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAH--GHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFGTTLNLISNTIFSIDL 638
            W ++VA  +FS     R  +   + LPPGP   P+IGNL +LG KPH+S+ KL++ +GP+MSLKFG V+TVV S+    KE+L+  D   C+R  P+  Y     ++   + + P +  WR +RK+     ++++++ + QH R++++  L+ ++++       +++ +     + ++I    F I+L
Sbjct:    4 WYIIVAFVFFSSMIIVRIIRKTKKNLPPGPPRLPIIGNLHQLGSKPHRSMFKLSETYGPLMSLKFGSVSTVVASTPETVKEVLKTFDVECCSR--PNMTYPARVTYNLKDLCFSPYSKYWREVRKMTVVELYTAKRVQSFQHTRKEEVAALVDFIKQAASLEKPVNLNKKLMKLSGSVICRVAFGINL 189          
The following BLAST results are available for this feature:
BLAST of FC931313 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 113
Match NameE-valueIdentityDescription
C76B1_HELTU6.094e-5249.767-ethoxycoumarin O-deethylase OS=Helianthus tubero... [more]
C76C4_ARATH1.234e-3639.25Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CY... [more]
C76C3_ARATH7.995e-3643.10Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CY... [more]
C80B1_ESCCA4.387e-3437.50(S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (F... [more]
C80B2_ESCCA1.667e-3335.44(S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS... [more]
C76C2_ARATH1.411e-3236.45Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CY... [more]
C76C1_ARATH2.662e-3136.04Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CY... [more]
C76A2_SOLME1.460e-2932.02Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76... [more]
F3PH_PETHY2.413e-2432.24Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=C... [more]
C71BC_ARATH1.564e-2330.85Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=C... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G08EF PostHarvP1 Citrus clementina cDNA clone C34103G08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931313 ID=FC931313|Name=FC931313|organism=Citrus clementina|type=EST|length=727bp
GGCACACCTGAATTTGGTGTTTCAAGAGCTTCAAACAAAAGAGAGCGAGA
TTAAAGATGGATATGGTAAGCTGCGTACCATGGCTTCTATTCTCGTGGAT
TTTGGTCGTCGCTTTAAATTACTTTTCAAGAGGATTCAAATCTGGATCCA
GAAGGCTTCCACCGGGACCGACGCCTTATCCGGTGATCGGAAACCTCCTG
GAACTCGGCGACAAACCTCACAAGTCACTTGCTAAACTTGCCAAGATTCA
TGGCCCCATAATGAGTCTAAAATTTGGCCAGGTGACCACAGTTGTCTTTT
CTTCTGCAGCCATGGCCAAAGAAATCCTTCAAAATCAAGACACATCTTTC
TGTAATCGAACGATCCCAGACGCAATCTACGCCCACGGCCATCATGAATT
CGGGATGCCCTGGCTGCCTGTGGCGACACTGTGGAGAAATCTTCGAAAAA
TATGCAACTCACATGCTTTCTCTAGTCGCCAACTCGATGCCAATCAGCAC
CTTCGGCGTAAGAAAATCCAAGATCTTCTAGCTTATGTCCAAGAAAATTG
CCGTGCAGGTACAGCAATACATATTGGCCAAGCTGCTTTCGGCACTACGC
TTAATTTGATATCCAACACAATTTTTTCTATTGACTTGGCTGATCCCACA
TCAAAAACTGCGCGAGAGTTTAAGCAACAAATTGGGGTATGATGGAAGAA
GCTGGAAGCCTAACTTGTCGATTTTTT
back to top