FC931314

Overview
NameFC931314
Unique NameFC931314
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length702
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15308 contig Ccv1_Contig15308:1..703. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931314 vs. ExPASy Swiss-Prot
Match: NCASE_ARATH (Neutral ceramidase OS=Arabidopsis thaliana GN=At2g38010 PE=3 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 1.318e-88
Identity = 150/217 (69.12%), Postives = 177/217 (81.57%), Query Frame = 2
Query:    2 KSNCGVLSPNVLGAFCIDSGLPCDFTHSTCGGKNEMCYGRGPGYPDEFESTRIIGERQFRKAVDLFNKASEKLEGKIDYRHSYLDFSQLEVAIPKQNGGSETVKTCXXXXXXXXXXXXXXXXXXXXFTQGDDKGNPFWRLVRDLLKKPDKEQINCQYPKPILLDTGEMKQPYDWAPSILPIQILQVGQLVILSVPGEFTTMAGRRLRDAVKTVVTTT 652
            +SNCG +SPN LG FCID+GLPCDF HSTC G+NE+CYGRGPGYPDEFESTRIIGE+QF+ AV+LFNKA+EKL+GKI Y+H+YLDFS L+V +PK  GGSETVKTC                    F QGDD+GN FWRLVR++L+ P  EQ+ CQ PKPILLDTGEMK+PYDWAPSILPIQIL++GQLVILSVPGEFTTMAGRRLRDA+K+ + ++
Sbjct:  323 QSNCGDVSPNTLGTFCIDTGLPCDFNHSTCNGQNELCYGRGPGYPDEFESTRIIGEKQFKMAVELFNKATEKLQGKIGYQHAYLDFSNLDVTVPKAGGGSETVKTCPAAMGFGFAAGTTDGPGAFDFKQGDDQGNVFWRLVRNVLRTPGPEQVQCQKPKPILLDTGEMKEPYDWAPSILPIQILRIGQLVILSVPGEFTTMAGRRLRDAIKSFLISS 539          
BLAST of FC931314 vs. ExPASy Swiss-Prot
Match: NCSEB_DICDI (Neutral ceramidase B OS=Dictyostelium discoideum GN=dcd2B PE=3 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 3.173e-50
Identity = 103/223 (46.19%), Postives = 138/223 (61.88%), Query Frame = 2
Query:    2 KSNCGVLSPNVLGAFCIDSGLPCDFTHSTCGGKNEMCYGRGPGYP-DEFESTRIIGERQFRKAVDLFNKASEKLEGKIDYRHSYLDFSQLEVAIPKQNGGSETVKTCXXXXXXXXXXXXXXXXXXXXFTQGDDK--GNPFWRLVRDLLKKPDKEQINCQYPKPILLDTGEMKQPYDWAPSILPIQILQVGQLVILSVPGEFTTMAGRRLRDAVKTVVTTTGES 661
            +SN G +SPN  G  C D G PCD+  STC G+NE C+  GPG   D FEST+IIG  QF KA++LFN AS ++ G + YRHS++ F+ + V  P  N G +   TC                    F Q D+   GNPFW  + D + KP  +QI CQ PKPILLD G M +P  W P ++PIQI+ +GQ+V+++VPGEFTTM+GRRLR++V+ ++   GES
Sbjct:  291 QSNEGDVSPNTRGPTCRD-GSPCDYKTSTCNGRNEECWSLGPGKDGDMFESTQIIGGNQFNKALELFNNASIQVSGPVQYRHSWVQFTNVSVE-PPYNSGVDNATTCRGAMGYSFAAGTTDGPGAFNFVQSDNNTSGNPFWNFIGDFIAKPTPDQIRCQSPKPILLDVG-MVEPIPWVPDVMPIQIVTIGQIVLVAVPGEFTTMSGRRLRNSVREII---GES 507          
BLAST of FC931314 vs. ExPASy Swiss-Prot
Match: NCSEA_DICDI (Neutral ceramidase A OS=Dictyostelium discoideum GN=dcd2A PE=1 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 7.314e-47
Identity = 97/216 (44.91%), Postives = 132/216 (61.11%), Query Frame = 2
Query:    2 KSNCGVLSPNVLGAFCIDSGLPCDFTHSTCGGKNEMCYGRGPGYP-DEFESTRIIGERQFRKAVDLFNKASEKLEGKIDYRHSYLDFSQLEVAIPKQNGGSETVKTCXXXXXXXXXXXXXXXXXXXXFTQGDDKG-NPFWRLVRDLLKKPDKEQINCQYPKPILLDTGEMKQPYDWAPSILPIQILQVGQLVILSVPGEFTTMAGRRLRDAVKTVV 643
            +SN G +SPN  G  C D G PCD+  STC GK E C+  GPG   D FEST+IIG  QF KA++LFN A+ ++ GKI YRH++  F+ + V  P  N G E   TC                    F QGD+   NPFW  +  ++ KP  +Q  CQ PKPIL+D G M +P  W P ++P+QI+ +GQ+V+++VPGEFTTM+GRRLR+ V+ ++
Sbjct:  286 QSNEGDVSPNTRGPTCRD-GKPCDYKTSTCNGKVEECWALGPGTDGDMFESTQIIGGNQFNKALELFNNATIQVSGKIQYRHTWKPFTNVSVEAP-YNSGVEGATTCRGAMGYSFAGGTTDGPGAFNFIQGDNSTTNPFWNFIGGIIAKPTPQQTACQAPKPILIDVG-MVEPIPWVPDVMPLQIITLGQIVLVAVPGEFTTMSGRRLRNTVREII 498          
BLAST of FC931314 vs. ExPASy Swiss-Prot
Match: ASAH2_RAT (Neutral ceramidase OS=Rattus norvegicus GN=Asah2 PE=1 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 2.692e-41
Identity = 93/212 (43.87%), Postives = 125/212 (58.96%), Query Frame = 2
Query:    5 SNCGVLSPNVLGAFCIDSGLPCDFTHSTC-GGKNEMCYGRGPGYPDEFESTRIIGERQFRKAVDLFNKASEKLEGKIDYRHSYLDFSQLEVAIPKQNGGSETVKTCXXXXXXXXXXXXXXXXXXXXFTQGDDKGNPFWRLVRD-LLKKPDKEQINCQYPKPILLDTGEMKQPYDWAPSILPIQILQVGQLVILSVPGEFTTMAGRRLRDAVK 634
            SN G +SPN+LG  C+++G  CD   STC  G   MC   GPG  D FEST IIG   ++KA +L   AS+++ G +   H +++ + + V    Q   + TVKTC                     TQG  +GN FW  +RD LL KP +E I CQ PKPIL+ TGE+ +P+ W P I+ IQI+ +G L I ++PGEFTTM+GRRLR+AVK
Sbjct:  329 SNLGDVSPNILGPHCVNTGESCDNDKSTCPSGGPSMCMASGPGQ-DMFESTHIIGRVIYQKAKELHASASQEVTGPVLTAHQWVNMTDVSV----QLNATHTVKTCKAALGYSFAAGTIDGVSGLNITQGTTEGNLFWDTLRDQLLGKPSEEIIECQKPKPILIHTGELTKPHPWQPDIVDIQIVTLGSLAIAAIPGEFTTMSGRRLREAVK 535          
BLAST of FC931314 vs. ExPASy Swiss-Prot
Match: ASAH2_HUMAN (Neutral ceramidase OS=Homo sapiens GN=ASAH2 PE=1 SV=2)

HSP 1 Score: 167.548 bits (423), Expect = 5.997e-41
Identity = 88/219 (40.18%), Postives = 129/219 (58.90%), Query Frame = 2
Query:    5 SNCGVLSPNVLGAFCIDSGLPCDFTHSTCG-GKNEMCYGRGPGYPDEFESTRIIGERQFRKAVDLFNKASEKLEGKIDYRHSYLDFSQLEVAIPKQNGGSETVKTCXXXXXXXXXXXXXXXXXXXXFTQGDDKGNPFWRLVRD-LLKKPDKEQINCQYPKPILLDTGEMKQPYDWAPSILPIQILQVGQLVILSVPGEFTTMAGRRLRDAVKTVVTTTG 655
            SN G +SPN+LG  CI++G  CD  +STC  G   MC  +GPG  D F+ST+IIG   +++A +L+  AS+++ G +   H ++D + + V +      +   KTC                    FTQG  +G+PFW  +RD +L KP +E   C  PKPILL TGE+ +P+ W P I+ +QI+ +G L I ++PGEFTTM+GRRLR+AV+    + G
Sbjct:  348 SNLGDVSPNILGPRCINTGESCDNANSTCPIGGPSMCIAKGPGQ-DMFDSTQIIGRAMYQRAKELYASASQEVTGPLASAHQWVDMTDVTVWL----NSTHASKTCKPALGYSFAAGTIDGVGGLNFTQGKTEGDPFWDTIRDQILGKPSEEIKECHKPKPILLHTGELSKPHPWHPDIVDVQIITLGSLAITAIPGEFTTMSGRRLREAVQAEFASHG 561          
BLAST of FC931314 vs. ExPASy Swiss-Prot
Match: ASA2C_HUMAN (Putative neutral ceramidase C OS=Homo sapiens GN=ASAH2C PE=2 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 5.997e-41
Identity = 88/219 (40.18%), Postives = 129/219 (58.90%), Query Frame = 2
Query:    5 SNCGVLSPNVLGAFCIDSGLPCDFTHSTCG-GKNEMCYGRGPGYPDEFESTRIIGERQFRKAVDLFNKASEKLEGKIDYRHSYLDFSQLEVAIPKQNGGSETVKTCXXXXXXXXXXXXXXXXXXXXFTQGDDKGNPFWRLVRD-LLKKPDKEQINCQYPKPILLDTGEMKQPYDWAPSILPIQILQVGQLVILSVPGEFTTMAGRRLRDAVKTVVTTTG 655
            SN G +SPN+LG  CI++G  CD  +STC  G   MC  +GPG  D F+ST+IIG   +++A +L+  AS+++ G +   H ++D + + V +      +   KTC                    FTQG  +G+PFW  +RD +L KP +E   C  PKPILL TGE+ +P+ W P I+ +QI+ +G L I ++PGEFTTM+GRRLR+AV+    + G
Sbjct:  190 SNLGDVSPNILGPRCINTGESCDNANSTCPIGGPSMCIAKGPGQ-DMFDSTQIIGRAMYQRAKELYASASQEVTGPLASAHQWVDMTDVTVWL----NSTHASKTCKPALGYSFAAGTIDGVGGLNFTQGKTEGDPFWDTIRDQILGKPSEEIKECHKPKPILLHTGELSKPHPWHPDIVDVQIITLGSLAITAIPGEFTTMSGRRLREAVQAEFASHG 403          
BLAST of FC931314 vs. ExPASy Swiss-Prot
Match: ASAH2_MOUSE (Neutral ceramidase OS=Mus musculus GN=Asah2 PE=1 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 1.745e-40
Identity = 89/212 (41.98%), Postives = 124/212 (58.49%), Query Frame = 2
Query:    5 SNCGVLSPNVLGAFCIDSGLPCDFTHSTC-GGKNEMCYGRGPGYPDEFESTRIIGERQFRKAVDLFNKASEKLEGKIDYRHSYLDFSQLEVAIPKQNGGSETVKTCXXXXXXXXXXXXXXXXXXXXFTQGDDKGNPFWRLVRD-LLKKPDKEQINCQYPKPILLDTGEMKQPYDWAPSILPIQILQVGQLVILSVPGEFTTMAGRRLRDAVK 634
            SN G +SPN+LG  C+++G  CD   STC  G   MC   GPG  D FEST IIG   ++KA +L+  AS+++ G +   H +++ + + V    Q   + TVKTC                     TQG  +G+PFW  +RD LL KP +E + CQ PKPILL +GE+  P+ W P I+ +QI+ VG L I ++PGE TTM+GRR R+A+K
Sbjct:  324 SNLGDVSPNILGPHCVNTGESCDNDKSTCPNGGPSMCMASGPGQ-DMFESTHIIGRIIYQKAKELYASASQEVTGPVLAAHQWVNMTDVSV----QLNATHTVKTCKPALGYSFAAGTIDGVSGLNITQGTTEGDPFWDTLRDQLLGKPSEEIVECQKPKPILLHSGELTIPHPWQPDIVDVQIVTVGSLAIAAIPGELTTMSGRRFREAIK 530          
BLAST of FC931314 vs. ExPASy Swiss-Prot
Match: ASAH2_DANRE (Neutral ceramidase OS=Danio rerio GN=asah2 PE=1 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 3.887e-40
Identity = 89/213 (41.78%), Postives = 124/213 (58.22%), Query Frame = 2
Query:    5 SNCGVLSPNVLGAFCIDSGLPCDFTHSTC--GGKNEMCYGRGPGYPDEFESTRIIGERQFRKAVDLFNKASEKLEGKIDYRHSYLDFSQLEVAIPKQNGGSETVKTCXXXXXXXXXXXXXXXXXXXXFTQGDDKGNPFWRLVRD-LLKKPDKEQINCQYPKPILLDTGEMKQPYDWAPSILPIQILQVGQLVILSVPGEFTTMAGRRLRDAVK 634
            SN G  SPN+ G  C+++GL CD+ +S+C  GGK + C   GPG  D FESTRIIGE  F+ A +L+  A ++L G +   H +++ +   V    Q   + T +TC                    F QGD +G+PFW  +RD +L  P  E   C  PKPIL  TGEM  P  W P+I+ +QI+ +G L +++VPGEFTTM+GRR+R+AVK
Sbjct:  306 SNLGDSSPNIRGPVCVNTGLKCDYINSSCPVGGK-KACIAFGPG-EDMFESTRIIGENMFKIAKELYGSAKQELHGPVYGAHQWVNMTDETV----QFNSTHTGRTCKPALGHSFAAGTTDGGGEFNFLQGDTEGDPFWDGIRDAVLGPPSNETKACHQPKPILFSTGEMDSPLPWHPAIVDVQIITIGSLAVVAVPGEFTTMSGRRIREAVK 512          
BLAST of FC931314 vs. ExPASy Swiss-Prot
Match: NCASE_DROME (Neutral ceramidase OS=Drosophila melanogaster GN=CDase PE=1 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 2.440e-34
Identity = 81/230 (35.22%), Postives = 116/230 (50.43%), Query Frame = 2
Query:    5 SNCGVLSPNVLGAFCIDSGLPCDFTHSTCGGKNEMCYGRGPGYPDEFESTRIIGERQFRKAVDLFNKASEK-----LEGKIDYRHSYLDFSQLEVAIPKQNGGS--------ETVKTCXXXXXXXXXXXXXXXXXXXXFTQGDDKGNPFWRLVRDLLKKPDKEQINCQYPKPILLDTGEMKQPYDWAPSILPIQILQVGQLVILSVPGEFTTMAGRRLRDAVKTVVTTTG 655
            SN G +SPN++G  C  SG  CD   S C      C+  GPG  D FEST+I+G+R    A+ L N+ S++     + G + + H ++D       +P  NG +        + ++ C                    F QG    NP W  VRD +  P +E I C  PKPILL TG    PY+W P I+  Q+L++G ++I +VP EFTTMAGRRLR+ ++   +  G
Sbjct:  270 SNLGDVSPNIMGPKCSISGNECDLLTSRCPTGEGDCFASGPG-KDMFESTQILGQRLADAALGLLNEQSQESTAREVTGDVRFIHQFVD-------MPNYNGSTYNPLSRKVDKIRGCQPAMGYSFAAGTTDGPGAFSFEQGTTTDNPMWNFVRDFIAAPTQEDIKCHEPKPILLATGRATFPYEWQPKIVSDQLLKIGDVIIAAVPCEFTTMAGRRLRNQIRAAASAVG 491          
BLAST of FC931314 vs. ExPASy Swiss-Prot
Match: NCASE_DROPS (Neutral ceramidase OS=Drosophila pseudoobscura pseudoobscura GN=CDase PE=3 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 9.274e-34
Identity = 80/230 (34.78%), Postives = 115/230 (50.00%), Query Frame = 2
Query:    5 SNCGVLSPNVLGAFCIDSGLPCDFTHSTCGGKNEMCYGRGPGYPDEFESTRIIGERQFRKAVDLFNKASEK-----LEGKIDYRHSYLDFSQLEVAIPKQNGGS--------ETVKTCXXXXXXXXXXXXXXXXXXXXFTQGDDKGNPFWRLVRDLLKKPDKEQINCQYPKPILLDTGEMKQPYDWAPSILPIQILQVGQLVILSVPGEFTTMAGRRLRDAVKTVVTTTG 655
            SN G +SPN++G  C  SG  CD   S C      C+  GPG  D  EST+I+G+R    A+ L N+ S++     + G + + H ++D       +P  NG +        + ++ C                    F QG    NP W  VRD +  P +E I C  PKPILL TG    PY+W P I+  Q+L++G ++I +VP EFTTMAGRRLR+ ++   +  G
Sbjct:  270 SNLGDVSPNIMGPKCSISGNECDLLTSRCPAGEGECFASGPGR-DMVESTQILGQRLADAALGLLNEQSQESTAREVTGDVRFIHQFVD-------MPNYNGSAYNPLSRKIDKIRGCQPAMGYSFAAGTTDGPGAFSFEQGTTTDNPMWNFVRDFIATPTQEDIKCHEPKPILLATGRATFPYEWQPKIVSDQLLKIGDVIIAAVPCEFTTMAGRRLRNQIRAAASAAG 491          
The following BLAST results are available for this feature:
BLAST of FC931314 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
NCASE_ARATH1.318e-8869.12Neutral ceramidase OS=Arabidopsis thaliana GN=At2g... [more]
NCSEB_DICDI3.173e-5046.19Neutral ceramidase B OS=Dictyostelium discoideum G... [more]
NCSEA_DICDI7.314e-4744.91Neutral ceramidase A OS=Dictyostelium discoideum G... [more]
ASAH2_RAT2.692e-4143.87Neutral ceramidase OS=Rattus norvegicus GN=Asah2 P... [more]
ASAH2_HUMAN5.997e-4140.18Neutral ceramidase OS=Homo sapiens GN=ASAH2 PE=1 S... [more]
ASA2C_HUMAN5.997e-4140.18Putative neutral ceramidase C OS=Homo sapiens GN=A... [more]
ASAH2_MOUSE1.745e-4041.98Neutral ceramidase OS=Mus musculus GN=Asah2 PE=1 S... [more]
ASAH2_DANRE3.887e-4041.78Neutral ceramidase OS=Danio rerio GN=asah2 PE=1 SV... [more]
NCASE_DROME2.440e-3435.22Neutral ceramidase OS=Drosophila melanogaster GN=C... [more]
NCASE_DROPS9.274e-3434.78Neutral ceramidase OS=Drosophila pseudoobscura pse... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G09EF PostHarvP1 Citrus clementina cDNA clone C34103G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931314 ID=FC931314|Name=FC931314|organism=Citrus clementina|type=EST|length=702bp
TAAGTCCAACTGCGGCGTTCTTAGCCCAAATGTGCTTGGAGCATTCTGTA
TAGATTCTGGGCTACCTTGTGACTTCACTCATAGTACCTGTGGTGGGAAG
AATGAGATGTGCTATGGCCGAGGACCTGGTTACCCAGACGAATTTGAAAG
TACACGTATTATTGGAGAGAGGCAATTTAGAAAAGCTGTAGATCTTTTCA
ATAAAGCATCCGAAAAATTAGAAGGAAAGATTGACTATCGTCACAGTTAT
CTGGACTTCTCCCAGCTTGAGGTGGCAATTCCTAAACAAAATGGAGGATC
AGAGACAGTAAAAACATGTCCTGCTGCTATGGGGTTTGCATTTGCTGCAG
GAACAACTGATGGACCAGGAGCATTTGATTTTACCCAAGGAGATGACAAG
GGCAATCCTTTTTGGAGGCTGGTACGCGACTTACTTAAAAAACCAGATAA
GGAACAAATTAATTGTCAGTACCCAAAGCCCATCTTACTCGATACTGGTG
AAATGAAGCAACCATACGACTGGGCACCTTCAATACTTCCAATTCAGATC
CTCCAAGTAGGGCAGCTAGTCATTCTTAGTGTACCTGGAGAGTTTACGAC
AATGGCTGGGAGGCGACTTCGTGATGCTGTGAAGACGGTGGTCACTACTA
CTGGTGAATCCNATAGCATGTTCATGTTGTTTTAGCTGGCTTGACTAATC
CT
back to top