FC931315

Overview
NameFC931315
Unique NameFC931315
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length752
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC931315_ssr85 microsatellite FC931315_ssr85:85..98. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of FC931315 vs. ExPASy Swiss-Prot
Match: MPCP_RAT (Phosphate carrier protein, mitochondrial OS=Rattus norvegicus GN=Slc25a3 PE=1 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 3.261e-27
Identity = 58/110 (52.73%), Postives = 69/110 (62.73%), Query Frame = 3
Query:  423 EMYSPAFYAACTAGGTLSCGLTHTAVTPLDLVKCNMQIDPAKYKSITSGFGVLLKEQGLKGFFRGWVPTLFGYSAQGACXXXXXXXXXXXXSDIAGPEYAAKYKTLIYLA 752
            E  S  +YA C  GG LSCGLTHTAV PLDLVKC MQ+DP KYK I +GF + LKE G++G  +GW PTL GYS QG C            S+I G E    ++T +YLA
Sbjct:   52 EFGSMKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSITLKEDGVRGLAKGWAPTLIGYSMQGLCKFGFYEVFKALYSNILGEENTYLWRTSLYLA 161          
BLAST of FC931315 vs. ExPASy Swiss-Prot
Match: MPCP_MOUSE (Phosphate carrier protein, mitochondrial OS=Mus musculus GN=Slc25a3 PE=1 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 3.261e-27
Identity = 58/110 (52.73%), Postives = 69/110 (62.73%), Query Frame = 3
Query:  423 EMYSPAFYAACTAGGTLSCGLTHTAVTPLDLVKCNMQIDPAKYKSITSGFGVLLKEQGLKGFFRGWVPTLFGYSAQGACXXXXXXXXXXXXSDIAGPEYAAKYKTLIYLA 752
            E  S  +YA C  GG LSCGLTHTAV PLDLVKC MQ+DP KYK I +GF + LKE G++G  +GW PTL GYS QG C            S+I G E    ++T +YLA
Sbjct:   53 EFGSMKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSITLKEDGVRGLAKGWAPTLIGYSMQGLCKFGFYEVFKALYSNILGEENTYLWRTSLYLA 162          
BLAST of FC931315 vs. ExPASy Swiss-Prot
Match: MPCP_PONAB (Phosphate carrier protein, mitochondrial OS=Pongo abelii GN=SLC25A3 PE=2 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.239e-26
Identity = 57/110 (51.82%), Postives = 68/110 (61.82%), Query Frame = 3
Query:  423 EMYSPAFYAACTAGGTLSCGLTHTAVTPLDLVKCNMQIDPAKYKSITSGFGVLLKEQGLKGFFRGWVPTLFGYSAQGACXXXXXXXXXXXXSDIAGPEYAAKYKTLIYLA 752
            E  S  +YA C  GG LSCGLTHTAV PLDLVKC MQ+DP KYK I +GF V LKE G++G  +GW PT  GYS QG C            S++ G E    ++T +YLA
Sbjct:   57 EFGSAKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLA 166          
BLAST of FC931315 vs. ExPASy Swiss-Prot
Match: MPCP_BOVIN (Phosphate carrier protein, mitochondrial OS=Bos taurus GN=SLC25A3 PE=1 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 3.052e-25
Identity = 54/107 (50.47%), Postives = 66/107 (61.68%), Query Frame = 3
Query:  432 SPAFYAACTAGGTLSCGLTHTAVTPLDLVKCNMQIDPAKYKSITSGFGVLLKEQGLKGFFRGWVPTLFGYSAQGACXXXXXXXXXXXXSDIAGPEYAAKYKTLIYLA 752
            S  F+  C  GG +SCG THTA+ PLDLVKC MQ+DP KYKSI +GF V LKE G +G  +GW PT  GYS QG C            S++ G E A  ++T +YLA
Sbjct:   61 SGRFFILCGLGGIISCGTTHTALVPLDLVKCRMQVDPQKYKSIFNGFSVTLKEDGFRGLAKGWAPTFIGYSLQGLCKFGFYEVFKVLYSNMLGEENAYLWRTSLYLA 167          
BLAST of FC931315 vs. ExPASy Swiss-Prot
Match: MPCP_CHOFU (Phosphate carrier protein, mitochondrial OS=Choristoneura fumiferana PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 8.881e-25
Identity = 51/113 (45.13%), Postives = 70/113 (61.95%), Query Frame = 3
Query:  414 EKIEMYSPAFYAACTAGGTLSCGLTHTAVTPLDLVKCNMQIDPAKYKSITSGFGVLLKEQGLKGFFRGWVPTLFGYSAQGACXXXXXXXXXXXXSDIAGPEYAAKYKTLIYLA 752
            +  E  S  ++A C  GG LSCG+THTAV PLDLVKC +Q+D  KYK++ +GF V ++E+GL+G  +GW PT  GYS QG C            +++   E A  Y+T +YLA
Sbjct:   39 DSCEFGSTKYFALCGLGGILSCGITHTAVVPLDLVKCRLQVDADKYKNVVNGFRVSVREEGLRGLAKGWAPTFIGYSLQGLCKFGLYEVFKVQYNNMLDEETAYTYRTFVYLA 151          
BLAST of FC931315 vs. ExPASy Swiss-Prot
Match: MPCP_HUMAN (Phosphate carrier protein, mitochondrial OS=Homo sapiens GN=SLC25A3 PE=1 SV=2)

HSP 1 Score: 112.849 bits (281), Expect = 1.978e-24
Identity = 52/107 (48.60%), Postives = 65/107 (60.75%), Query Frame = 3
Query:  432 SPAFYAACTAGGTLSCGLTHTAVTPLDLVKCNMQIDPAKYKSITSGFGVLLKEQGLKGFFRGWVPTLFGYSAQGACXXXXXXXXXXXXSDIAGPEYAAKYKTLIYLA 752
            S  F+  C  GG +SCG THTA+ PLDLVKC MQ+DP KYK I +GF V LKE G++G  +GW PT  GYS QG C            S++ G E    ++T +YLA
Sbjct:   61 SGRFFILCGLGGIISCGTTHTALVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLA 167          
BLAST of FC931315 vs. ExPASy Swiss-Prot
Match: MPCP_CAEEL (Phosphate carrier protein, mitochondrial OS=Caenorhabditis elegans GN=F01G4.6 PE=2 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 4.408e-24
Identity = 51/112 (45.54%), Postives = 68/112 (60.71%), Query Frame = 3
Query:  417 KIEMYSPAFYAACTAGGTLSCGLTHTAVTPLDLVKCNMQIDPAKYKSITSGFGVLLKEQGLKGFFRGWVPTLFGYSAQGACXXXXXXXXXXXXSDIAGPEYAAKYKTLIYLA 752
            ++E  S  +YA C  GG LSCG+THTA+ PLDLVKC +Q++P KY  I +GF   + E+G +   +GW PTL GYSAQG              +D+ G E A  Y+T +YLA
Sbjct:   34 QVEFGSGKYYAYCALGGVLSCGITHTAIVPLDLVKCRIQVNPEKYTGIATGFRTTIAEEGARALVKGWAPTLLGYSAQGLGKFGFYEIFKNVYADMLGEENAYLYRTSLYLA 145          
BLAST of FC931315 vs. ExPASy Swiss-Prot
Match: MPCP_SCHPO (Probable mitochondrial phosphate carrier protein OS=Schizosaccharomyces pombe GN=SPBC1703.13c PE=2 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 5.756e-24
Identity = 49/115 (42.61%), Postives = 72/115 (62.61%), Query Frame = 3
Query:  408 PKEKIEMYSPAFYAACTAGGTLSCGLTHTAVTPLDLVKCNMQIDPAKYKSITSGFGVLLKEQGLKGFFRGWVPTLFGYSAQGACXXXXXXXXXXXXSDIAGPEYAAKYKTLIYLA 752
            PK+ +++Y+P +Y  CT GG L+CG TH+A+TPLDL+KC  Q++P  Y    +GF  +L ++GL+G + G +PTL GYS QG              S + G + A +Y+T IYLA
Sbjct:   11 PKKTLQLYTPQYYGLCTLGGLLACGTTHSAITPLDLIKCRKQVNPNIYPGNIAGFKTILSKEGLRGLYTGGMPTLIGYSLQGCGKYGFYELFKHKYSTLVGAQKAHEYRTSIYLA 125          
BLAST of FC931315 vs. ExPASy Swiss-Prot
Match: PIC2_YEAST (Mitochondrial phosphate carrier protein 2 OS=Saccharomyces cerevisiae GN=PIC2 PE=1 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 5.219e-17
Identity = 38/80 (47.50%), Postives = 54/80 (67.50%), Query Frame = 3
Query:  417 KIEMYSPAFYAACTAGGTLSCGLTHTAVTPLDLVKCNMQIDPAKYKSITSGFGVLLKEQGLKGFFRGWVPTLFGYSAQGA 656
            KI++Y+  FYA CT GG ++CG TH+++TPLDLVKC +Q++P  Y S   GF  ++  +G K  + G+  T  GYS QGA
Sbjct:    9 KIQLYTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGA 88          
BLAST of FC931315 vs. ExPASy Swiss-Prot
Match: MCFN_DICDI (Mitochondrial substrate carrier family protein N OS=Dictyostelium discoideum GN=mcfN PE=3 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 5.971e-13
Identity = 39/107 (36.45%), Postives = 58/107 (54.21%), Query Frame = 3
Query:  432 SPAFYAACTAGGTLSCGLTHTAVTPLDLVKCNMQIDPAKYKSITSGFGVLLKEQGLKGFFRGWVPTLFGYSAQGACXXXXXXXXXXXXSDIAGPEYAAKYKTLIYLA 752
            +P+ +     GG LSC +TH+ V PLD+VK  +Q +P KY  + +GF  ++KEQG  G  +G  PT  GY+ QG              +D  G E A +++  I+LA
Sbjct:    6 TPSLFLKYGFGGALSCSITHSLVVPLDVVKTLLQTNPGKYTGMMNGFSTVIKEQGPSGLLQGLGPTAVGYALQGFLKFGFYEVFKKTYADAVG-EKADQFRIPIWLA 111          
The following BLAST results are available for this feature:
BLAST of FC931315 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
MPCP_RAT3.261e-2752.73Phosphate carrier protein, mitochondrial OS=Rattus... [more]
MPCP_MOUSE3.261e-2752.73Phosphate carrier protein, mitochondrial OS=Mus mu... [more]
MPCP_PONAB1.239e-2651.82Phosphate carrier protein, mitochondrial OS=Pongo ... [more]
MPCP_BOVIN3.052e-2550.47Phosphate carrier protein, mitochondrial OS=Bos ta... [more]
MPCP_CHOFU8.881e-2545.13Phosphate carrier protein, mitochondrial OS=Choris... [more]
MPCP_HUMAN1.978e-2448.60Phosphate carrier protein, mitochondrial OS=Homo s... [more]
MPCP_CAEEL4.408e-2445.54Phosphate carrier protein, mitochondrial OS=Caenor... [more]
MPCP_SCHPO5.756e-2442.61Probable mitochondrial phosphate carrier protein O... [more]
PIC2_YEAST5.219e-1747.50Mitochondrial phosphate carrier protein 2 OS=Sacch... [more]
MCFN_DICDI5.971e-1336.45Mitochondrial substrate carrier family protein N O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103G10EF PostHarvP1 Citrus clementina cDNA clone C34103G10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931315 ID=FC931315|Name=FC931315|organism=Citrus clementina|type=EST|length=752bp
GGAACATCCTCGTTTTCATTTAAAGCTGATTTCTCGCGCTCCATTTATGG
CTCCAACCACAAACGTTCCCCTTTCATTCGTTCCCTCTCTCTCTCTCTAT
TCAGAAACAGTCTCATTTTTCATTTTTTCTTTTTCTTTCTCGTGAGAGGC
CAATACAACACAAATAAAGCTAAAATAAACGAACCTTTGATTTCGATATA
ATTACGAAAATGGGACAGTCGGACGATCAGCACTACTCTCGCCAGTCACT
GATGCCGAGCTTTCTCTACTCGTCGTCGTCCAAACGGCTCTTCTATTTGG
ACGCCCTGATGAATAATACTAAAGCTGGATTGTTGAATCGATCAGCGCAG
TCCGTTTCGCCGTCATCCAGTGGTGCGTCGAAAAAAGCCAGCTTTGTGAT
TCCGGCGCCGAAAGAGAAGATTGAGATGTACTCGCCTGCTTTTTACGCCG
CGTGTACAGCCGGCGGGACGTTGAGCTGCGGCCTCACTCACACGGCCGTG
ACTCCTCTCGATCTCGTTAAATGCAATATGCAGATTGACCCAGCAAAGTA
CAAGAGCATTACGTCTGGATTTGGAGTGTTGCTCAAGGAGCAGGGACTGA
AGGGCTTCTTCAGAGGTTGGGTACCAACCCTGTTTGGTTACAGCGCTCAA
GGTGCCTGCAAGTTTGGATTCTATGAGTTCTTTAAGAAGTATTACTCGGA
CATTGCTGGGCCTGAGTATGCTGCCAAGTACAAGACATTGATATACCTTG
CC
back to top