FC931325

Overview
NameFC931325
Unique NameFC931325
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length718
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig11439 contig Ccv1_Contig11439:92..809. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931325 vs. ExPASy Swiss-Prot
Match: ATX3H_ARATH (Ataxin-3 homolog OS=Arabidopsis thaliana GN=At3g54130 PE=2 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 4.268e-74
Identity = 137/161 (85.09%), Postives = 143/161 (88.82%), Query Frame = 2
Query:  239 MEGASNGGMLYHEVQESKLCAVHCVNTVLQGPFFSEFDLAALASDLDRSERQVMLEGR-VPAASSGDFLTEESHNVSLDGDFSIQVLQKALEVRDLQVIPLNCPIAEPAQIDPELENAFICHLHDHWFCIRKVNGEWYNFDSLYAAPEHPLKFYLSAYLDS 718
            ME  SNGGMLYHEVQES LCAVHCVNTVLQGPFFSEFDLAA+A+DLD  ERQVMLEG  V   + GDFL EESHNVSL GDFSIQVLQKALEV DLQVIPLNCP AEPAQIDPELE+AFICHLHDHWFCIRKVNGEWYNFDSL AAP+H  KFYLSA+LDS
Sbjct:    1 MERTSNGGMLYHEVQESNLCAVHCVNTVLQGPFFSEFDLAAVAADLDGKERQVMLEGAAVGGFAPGDFLAEESHNVSLGGDFSIQVLQKALEVWDLQVIPLNCPDAEPAQIDPELESAFICHLHDHWFCIRKVNGEWYNFDSLLAAPQHLSKFYLSAFLDS 161          
BLAST of FC931325 vs. ExPASy Swiss-Prot
Match: ATX3_ORYSJ (Putative ataxin-3 homolog OS=Oryza sativa subsp. japonica GN=Os01g0851400 PE=3 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 1.987e-63
Identity = 122/161 (75.78%), Postives = 132/161 (81.99%), Query Frame = 2
Query:  248 ASNGGMLYHEVQESKLCAVHCVNTVLQGPFFSEFDLAALASDLDRSERQVMLEGRVPAASS--GDFLTEE--SHNVSLDGDFSIQVLQKALEVRDLQVIPLNCPIAEPAQIDPELENAFICHLHDHWFCIRKVNGEWYNFDSLYAAPEHPLKFYLSAYLDS 718
            ASNGG+LYHEVQE KLCAVHCVNT LQGPFFSEFDL+ALA DLD+ ERQVM EG   AA++  GDFL E   SHNVSL GDFSIQVLQKALEV DLQVIPL+ P       DPELE AFICHL DHWFCIRKVNGEWYNF+SLY APEH  KFYLSA++D+
Sbjct:    7 ASNGGLLYHEVQEGKLCAVHCVNTTLQGPFFSEFDLSALAVDLDQRERQVMSEGAAGAATTAAGDFLAEGEGSHNVSLGGDFSIQVLQKALEVWDLQVIPLDSPDVGSCLFDPELETAFICHLQDHWFCIRKVNGEWYNFNSLYPAPEHLSKFYLSAFIDT 167          
BLAST of FC931325 vs. ExPASy Swiss-Prot
Match: ATX3_HUMAN (Ataxin-3 OS=Homo sapiens GN=ATXN3 PE=1 SV=3)

HSP 1 Score: 128.257 bits (321), Expect = 4.182e-29
Identity = 63/149 (42.28%), Postives = 91/149 (61.07%), Query Frame = 2
Query:  266 LYHEVQESKLCAVHCVNTVLQGPFFSEFDLAALASDLDRSERQVMLEGRVPAASSGDFLTEESHNVSLDGDFSIQVLQKALEVRDLQVIPLNCPIAEPAQIDPELENAFICHLHDHWFCIRKVNGEWYNFDSLYAAPEHPLKFYLSAYL 712
            ++HE QE  LCA HC+N +LQG +FS  +L+++A  LD  ER  M EG V +     FL + S N+   G FSIQV+  AL+V  L++I  N P  +  +IDP  E +FIC+  +HWF +RK+  +W+N +SL   PE     YL+ +L
Sbjct:    4 IFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFL 152          
BLAST of FC931325 vs. ExPASy Swiss-Prot
Match: ATX3_RAT (Ataxin-3 OS=Rattus norvegicus GN=Atxn3 PE=2 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 7.134e-29
Identity = 63/149 (42.28%), Postives = 91/149 (61.07%), Query Frame = 2
Query:  266 LYHEVQESKLCAVHCVNTVLQGPFFSEFDLAALASDLDRSERQVMLEGRVPAASSGDFLTEESHNVSLDGDFSIQVLQKALEVRDLQVIPLNCPIAEPAQIDPELENAFICHLHDHWFCIRKVNGEWYNFDSLYAAPEHPLKFYLSAYL 712
            ++HE QE  LCA HC+N +LQG +FS  +L+++A  LD  ER  M EG V +     FL + S N+   G FSIQV+  AL+V  L++I  N P  +  +IDP  E +FIC+  +HWF +RK+  +W+N +SL   PE     YL+ +L
Sbjct:    4 IFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERLRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFL 152          
BLAST of FC931325 vs. ExPASy Swiss-Prot
Match: ATX3_MOUSE (Ataxin-3 OS=Mus musculus GN=Atxn3 PE=1 SV=2)

HSP 1 Score: 127.487 bits (319), Expect = 7.134e-29
Identity = 63/149 (42.28%), Postives = 91/149 (61.07%), Query Frame = 2
Query:  266 LYHEVQESKLCAVHCVNTVLQGPFFSEFDLAALASDLDRSERQVMLEGRVPAASSGDFLTEESHNVSLDGDFSIQVLQKALEVRDLQVIPLNCPIAEPAQIDPELENAFICHLHDHWFCIRKVNGEWYNFDSLYAAPEHPLKFYLSAYL 712
            ++HE QE  LCA HC+N +LQG +FS  +L+++A  LD  ER  M EG V +     FL + S N+   G FSIQV+  AL+V  L++I  N P  +  +IDP  E +FIC+  +HWF +RK+  +W+N +SL   PE     YL+ +L
Sbjct:    4 IFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERLRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFL 152          
BLAST of FC931325 vs. ExPASy Swiss-Prot
Match: ATX3_CHICK (Ataxin-3 OS=Gallus gallus GN=ATXN3 PE=2 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 1.589e-28
Identity = 63/149 (42.28%), Postives = 90/149 (60.40%), Query Frame = 2
Query:  266 LYHEVQESKLCAVHCVNTVLQGPFFSEFDLAALASDLDRSERQVMLEGRVPAASSGDFLTEESHNVSLDGDFSIQVLQKALEVRDLQVIPLNCPIAEPAQIDPELENAFICHLHDHWFCIRKVNGEWYNFDSLYAAPEHPLKFYLSAYL 712
            ++HE QE  LCA HC+N +LQG +FS  +L+++A  LD  ER  M EG V +     FL + S N+   G FSIQV+  AL+V  L++I  N P  +   IDP  E +FIC+  +HWF +RK+  +W+N +SL   PE     YL+ +L
Sbjct:    4 IFHERQEGSLCAQHCLNNLLQGEYFSPVELSSIAQQLDEEERMRMAEGGVSSEEYRTFLQQPSVNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLGIDPINEKSFICNYKEHWFTVRKLGKQWFNLNSLLMGPELISDTYLALFL 152          
BLAST of FC931325 vs. ExPASy Swiss-Prot
Match: ATX3L_HUMAN (Putative ataxin-3-like protein OS=Homo sapiens GN=ATXN3L PE=5 SV=2)

HSP 1 Score: 122.094 bits (305), Expect = 2.997e-27
Identity = 62/138 (44.93%), Postives = 82/138 (59.42%), Query Frame = 2
Query:  266 LYHEVQESKLCAVHCVNTVLQGPFFSEFDLAALASDLDRSERQVMLEGRVPAASSGDFLTEESHNVSLDGDFSIQVLQKALEVRDLQVIPLNCPIAEPAQIDPELENAFICHLHDHWFCIRKVNGEWYNFDSLYAAPE 679
            ++HE QE  LCA HC+N +LQG +FS  +LA++A  LD  ER  M EG V +     FL + S N+   G FSIQV+  AL+   L++I  N P  +   IDP  E +FIC+   HWF IRK    W+N +SL A PE
Sbjct:    4 IFHEKQEGFLCAQHCLNNLLQGEYFSPVELASIAHQLDEEERMRMAEGGVTSEEYLAFLQQPSENMDDTGFFSIQVISNALKFWGLEIIHFNNPEYQKLGIDPINERSFICNYKQHWFTIRKFGKHWFNLNSLLAGPE 141          
BLAST of FC931325 vs. ExPASy Swiss-Prot
Match: ATX3_CAEEL (Ataxin-3 homolog OS=Caenorhabditis elegans GN=atx-3 PE=1 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 3.673e-17
Identity = 48/149 (32.21%), Postives = 80/149 (53.69%), Query Frame = 2
Query:  266 LYHEVQESKLCAVHCVNTVLQGPFFSEFDLAALASDLDRSERQVMLEGRVPAASSGDFLTEESHNVSLDGDFSIQVLQKALEVRDLQVIPLNCPIAEPAQIDPELENAFICHLHDHWFCIRKVNGEWYNFDSLYAAPEHPLKFYLSAYL 712
            ++ E QE+ LCA H +N +LQ   +   DL  LA  +D+ E+Q++         + +     S N++  G FSIQVL+KALE   L++  +  P     + +P    A+IC+L +HWF +RK   +W+  +S+   P+     Y+S +L
Sbjct:   10 IFFEHQEAALCAQHALNMLLQDALYKWQDLRDLAIQMDKMEQQIL--------GNANPTPGRSENMNESGYFSIQVLEKALETFSLKLTNIENPAMVDYKNNPLTARAYICNLREHWFVLRKFGNQWFELNSVNRGPKLLSDTYVSMFL 150          
BLAST of FC931325 vs. ExPASy Swiss-Prot
Match: ATX3_CAEBR (Ataxin-3 homolog OS=Caenorhabditis briggsae GN=atx-3 PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 5.303e-16
Identity = 45/149 (30.20%), Postives = 78/149 (52.35%), Query Frame = 2
Query:  266 LYHEVQESKLCAVHCVNTVLQGPFFSEFDLAALASDLDRSERQVMLEGRVPAASSGDFLTEESHNVSLDGDFSIQVLQKALEVRDLQVIPLNCPIAEPAQIDPELENAFICHLHDHWFCIRKVNGEWYNFDSLYAAPEHPLKFYLSAYL 712
            ++ E Q++ LCA H +N +LQ   F+  +L  LA  +D+ E  ++         +       S N++  G FSIQV++KALE  DL++I +  P     + +P    A++ +L +HWF +RK   +W+  +S+   P+     Y+  YL
Sbjct:   11 IFFERQQAALCAQHALNMLLQDSLFTYENLRDLARQMDQMEHDIL--------GNNANAVGRSENMNDSGFFSIQVIEKALETFDLKLINMENPAMAEFKANPLTARAYVLNLREHWFVLRKFGNQWFELNSVKNGPKLLTDTYVKEYL 151          
The following BLAST results are available for this feature:
BLAST of FC931325 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
ATX3H_ARATH4.268e-7485.09Ataxin-3 homolog OS=Arabidopsis thaliana GN=At3g54... [more]
ATX3_ORYSJ1.987e-6375.78Putative ataxin-3 homolog OS=Oryza sativa subsp. j... [more]
ATX3_HUMAN4.182e-2942.28Ataxin-3 OS=Homo sapiens GN=ATXN3 PE=1 SV=3[more]
ATX3_RAT7.134e-2942.28Ataxin-3 OS=Rattus norvegicus GN=Atxn3 PE=2 SV=1[more]
ATX3_MOUSE7.134e-2942.28Ataxin-3 OS=Mus musculus GN=Atxn3 PE=1 SV=2[more]
ATX3_CHICK1.589e-2842.28Ataxin-3 OS=Gallus gallus GN=ATXN3 PE=2 SV=1[more]
ATX3L_HUMAN2.997e-2744.93Putative ataxin-3-like protein OS=Homo sapiens GN=... [more]
ATX3_CAEEL3.673e-1732.21Ataxin-3 homolog OS=Caenorhabditis elegans GN=atx-... [more]
ATX3_CAEBR5.303e-1630.20Ataxin-3 homolog OS=Caenorhabditis briggsae GN=atx... [more]
back to top
Properties
Property NameValue
Genbank descriptionC34103H08EF PostHarvP1 Citrus clementina cDNA clone C34103H08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931325 ID=FC931325|Name=FC931325|organism=Citrus clementina|type=EST|length=718bp
GATGACTCCTTACTTTCTTCAAGTCACGCCAAGCAAAGCAAATACCGATT
ATATATTTATATTTATTTAATGAATAAAATTATAAATTCTTTTCCCTCAT
CTTCCTCTTCTCTCCATCGAACATTCGAAACTGAAAAACCTTTCCTAAGA
AACCCGCTGTTACAATAATATCGCAAATAGAAAAAAAAAAATCTAGGTTT
TGTTACCTGGTGCACATAAGAGTTTGTTTTTTTTATTAATGGAAGGGGCG
AGCAACGGAGGGATGTTGTACCACGAGGTACAAGAGTCGAAGCTATGCGC
GGTGCATTGCGTGAACACGGTGTTACAAGGTCCGTTTTTCTCGGAGTTCG
ATTTGGCGGCGCTGGCTTCGGATCTCGATCGTAGTGAGCGCCAGGTGATG
CTCGAAGGTCGCGTCCCCGCTGCTTCCTCCGGCGATTTCCTCACCGAGGA
GTCTCATAACGTCTCTCTCGACGGCGATTTCAGTATCCAGGTTCTGCAAA
AGGCTTTAGAGGTGCGGGATCTGCAAGTCATTCCCCTTAACTGCCCAATT
GCTGAACCTGCCCAGATTGACCCTGAGCTAGAAAATGCGTTTATCTGTCA
TTTGCACGACCACTGGTTCTGTATCAGGAAAGTGAATGGAGAATGGTATA
ATTTTGACAGTCTTTATGCAGCCCCAGAGCACCCTCTCAAGTTTTACCTG
TCAGCCTATCTGGATTCG
back to top