FC931327

Overview
NameFC931327
Unique NameFC931327
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length710
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig369 contig Ccv1_Contig369:3..712. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931327 vs. ExPASy Swiss-Prot
Match: RLA0_SOYBN (60S acidic ribosomal protein P0 OS=Glycine max PE=2 SV=1)

HSP 1 Score: 291.582 bits (745), Expect = 2.823e-78
Identity = 150/178 (84.27%), Postives = 157/178 (88.20%), Query Frame = 1
Query:  175 MVVKASKAEKKIAYDAKLCQLLEEYTQILVAAADNVGSNQLQNIRRGLRGDSVVLMGKNTMMKRTIRMHAEKTGNTAFLNLIPLLQGNVGLIFTKGDLXXXXXXXXXXXXGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALL 708
            M  K +KAEKKIAYDAKLC L+EEY QILV  +DNVGSNQLQNIR+GLRGDSVVLMGKNTMMKR++RMHAEKTGN A+LNLIPLL GNVGLIFTKGDL            GAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALL
Sbjct:    1 MAPKQTKAEKKIAYDAKLCDLMEEYGQILVVNSDNVGSNQLQNIRKGLRGDSVVLMGKNTMMKRSVRMHAEKTGNNAYLNLIPLLVGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALL 178          
BLAST of FC931327 vs. ExPASy Swiss-Prot
Match: RLA01_ARATH (60S acidic ribosomal protein P0-1 OS=Arabidopsis thaliana GN=RPP0A PE=2 SV=1)

HSP 1 Score: 290.041 bits (741), Expect = 8.212e-78
Identity = 148/178 (83.15%), Postives = 159/178 (89.33%), Query Frame = 1
Query:  175 MVVKASKAEKKIAYDAKLCQLLEEYTQILVAAADNVGSNQLQNIRRGLRGDSVVLMGKNTMMKRTIRMHAEKTGNTAFLNLIPLLQGNVGLIFTKGDLXXXXXXXXXXXXGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALL 708
            M VKA+KAEKKI YD+KLCQLL EY+QILV AADNVGS QLQNIR+GLRGDSVVLMGKNTMMKR++R+HA+KTGN AFL+L+PLLQGNVGLIFTKGDL            GAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALL
Sbjct:    1 MAVKATKAEKKIVYDSKLCQLLNEYSQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMMKRSVRIHADKTGNQAFLSLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL 178          
BLAST of FC931327 vs. ExPASy Swiss-Prot
Match: RLA02_ARATH (60S acidic ribosomal protein P0-2 OS=Arabidopsis thaliana GN=RPP0B PE=1 SV=2)

HSP 1 Score: 289.656 bits (740), Expect = 1.073e-77
Identity = 147/177 (83.05%), Postives = 159/177 (89.83%), Query Frame = 1
Query:  178 VVKASKAEKKIAYDAKLCQLLEEYTQILVAAADNVGSNQLQNIRRGLRGDSVVLMGKNTMMKRTIRMHAEKTGNTAFLNLIPLLQGNVGLIFTKGDLXXXXXXXXXXXXGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALL 708
            +VKA+KAEKKIAYD KLCQL++EYTQILV AADNVGS QLQNIR+GLRGDSVVLMGKNTMMKR++R+H+E TGNTA LNL+PLLQGNVGLIFTKGDL            GAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI++GDKVGSSEAALL
Sbjct:    1 MVKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMMKRSVRIHSENTGNTAILNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALL 177          
BLAST of FC931327 vs. ExPASy Swiss-Prot
Match: RLA03_ARATH (60S acidic ribosomal protein P0-3 OS=Arabidopsis thaliana GN=RPP0C PE=1 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 3.121e-77
Identity = 146/177 (82.49%), Postives = 159/177 (89.83%), Query Frame = 1
Query:  178 VVKASKAEKKIAYDAKLCQLLEEYTQILVAAADNVGSNQLQNIRRGLRGDSVVLMGKNTMMKRTIRMHAEKTGNTAFLNLIPLLQGNVGLIFTKGDLXXXXXXXXXXXXGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALL 708
            +VKA+KAEKKIAYD KLCQL++EYTQILV AADNVGS QLQNIR+GLRGDSVVLMGKNTMMKR++R+H+E +GNTA LNL+PLLQGNVGLIFTKGDL            GAPARVGLVAPIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI++GDKVGSSEAALL
Sbjct:    1 MVKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMMKRSVRIHSENSGNTAILNLLPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALL 177          
BLAST of FC931327 vs. ExPASy Swiss-Prot
Match: RLA0_LUPLU (60S acidic ribosomal protein P0 OS=Lupinus luteus PE=2 SV=1)

HSP 1 Score: 284.263 bits (726), Expect = 4.506e-76
Identity = 148/178 (83.15%), Postives = 155/178 (87.08%), Query Frame = 1
Query:  175 MVVKASKAEKKIAYDAKLCQLLEEYTQILVAAADNVGSNQLQNIRRGLRGDSVVLMGKNTMMKRTIRMHAEKTGNTAFLNLIPLLQGNVGLIFTKGDLXXXXXXXXXXXXGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALL 708
            M  KA+KAEKKI YD KLCQLL+EYTQILV  ADNVGS QLQNIR+GLRGDSVVLMGKNTMMKR++R+HAEKTGN AFLNLIPLL GNVGLIFTKG L            GAPA VGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALL
Sbjct:    1 MAPKATKAEKKIVYDGKLCQLLDEYTQILVVNADNVGSKQLQNIRQGLRGDSVVLMGKNTMMKRSVRIHAEKTGNQAFLNLIPLLIGNVGLIFTKGYLKEVSEEVAKYKVGAPACVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL 178          
BLAST of FC931327 vs. ExPASy Swiss-Prot
Match: RLA0_ORYSJ (60S acidic ribosomal protein P0 OS=Oryza sativa subsp. japonica GN=Os08g0130500 PE=1 SV=3)

HSP 1 Score: 276.559 bits (706), Expect = 9.396e-74
Identity = 136/178 (76.40%), Postives = 155/178 (87.08%), Query Frame = 1
Query:  175 MVVKASKAEKKIAYDAKLCQLLEEYTQILVAAADNVGSNQLQNIRRGLRGDSVVLMGKNTMMKRTIRMHAEKTGNTAFLNLIPLLQGNVGLIFTKGDLXXXXXXXXXXXXGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALL 708
            M +K +KAEKK+AYD KLCQLL+EYT++L+A ADNVGSNQLQ IR+GLRGDS+VLMGKNT+++R I++HA+ TGN  FL L+PLL GNVGLIFTKGDL            GAPARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSE+ALL
Sbjct:    1 MAIKRTKAEKKVAYDKKLCQLLDEYTKVLIAVADNVGSNQLQEIRKGLRGDSIVLMGKNTLIRRCIKVHADNTGNKEFLELMPLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALL 178          
BLAST of FC931327 vs. ExPASy Swiss-Prot
Match: RLA0_MAIZE (60S acidic ribosomal protein P0 OS=Zea mays GN=RP-P0 PE=1 SV=3)

HSP 1 Score: 266.544 bits (680), Expect = 9.723e-71
Identity = 135/178 (75.84%), Postives = 153/178 (85.96%), Query Frame = 1
Query:  175 MVVKASKAEKKIAYDAKLCQLLEEYTQILVAAADNVGSNQLQNIRRGLRGDSVVLMGKNTMMKRTIRMHAEKTGNTAFLNLIPLLQGNVGLIFTKGDLXXXXXXXXXXXXGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALL 708
            M +K +KAEKKIAYD KLC LL+EYT++L+A ADNVGS QLQ+IRRGLRGDSVVLMGKNT+++R I+++AEKTGN  F  L+ LL GNVGLIFTKGDL            GAPARVGLVAP+DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KG+KVGSSE+ALL
Sbjct:    1 MAIKRTKAEKKIAYDKKLCSLLDEYTKVLIALADNVGSKQLQDIRRGLRGDSVVLMGKNTLIRRCIKVYAEKTGNHTFDPLMDLLVGNVGLIFTKGDLKEVREEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSESALL 178          
BLAST of FC931327 vs. ExPASy Swiss-Prot
Match: RLA0_CHERU (60S acidic ribosomal protein P0 OS=Chenopodium rubrum PE=2 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 4.826e-70
Identity = 137/178 (76.97%), Postives = 149/178 (83.71%), Query Frame = 1
Query:  175 MVVKASKAEKKIAYDAKLCQLLEEYTQILVAAADNVGSNQLQNIRRGLRGDSVVLMGKNTMMKRTIRMHAEKTGNTAFLNLIPLLQGNVGLIFTKGDLXXXXXXXXXXXXGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALL 708
            M VK +KAEKKIAYD KLCQLL+EY+Q+L+A+ADNVGSNQLQ IR GLRGDS+VLMGKNTMMKR+IR+HAE TGN    N+  L   NVGLIFTKGDL            GAPAR GLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIIT VELI+KG+KVGSSEAALL
Sbjct:    1 MAVKPTKAEKKIAYDQKLCQLLDEYSQVLIASADNVGSNQLQAIRIGLRGDSIVLMGKNTMMKRSIRLHAENTGNENLRNVEQLFLPNVGLIFTKGDLNQVREEISKYKVGAPARFGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITAVELIKKGEKVGSSEAALL 178          
BLAST of FC931327 vs. ExPASy Swiss-Prot
Match: RLA0_CERCA (60S acidic ribosomal protein P0 OS=Ceratitis capitata GN=RpLP0 PE=3 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 1.197e-44
Identity = 92/177 (51.98%), Postives = 119/177 (67.23%), Query Frame = 1
Query:  178 VVKASKAEKKIAYDAKLCQLLEEYTQILVAAADNVGSNQLQNIRRGLRGDSVVLMGKNTMMKRTIRMHAEKTGNTAFLNLIPLLQGNVGLIFTKGDLXXXXXXXXXXXXGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALL 708
            +V+ +KA  K  Y  K+ +L +EY +  +  ADNVGS Q+QNIR  LRG  VVLMGKNTMM++ IR H E   N     L+P ++GNVG +FTKGDL             APAR G +AP+ V++P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL
Sbjct:    1 MVRENKAAWKAQYFLKVVELFDEYPKCFIVGADNVGSKQMQNIRTSLRGLGVVLMGKNTMMRKAIRGHLEN--NAQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARAGAIAPLPVIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVPILKPGDKVGASEATLL 175          
BLAST of FC931327 vs. ExPASy Swiss-Prot
Match: RLA0_DROME (60S acidic ribosomal protein P0 OS=Drosophila melanogaster GN=RpLP0 PE=1 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 5.940e-44
Identity = 91/177 (51.41%), Postives = 120/177 (67.80%), Query Frame = 1
Query:  178 VVKASKAEKKIAYDAKLCQLLEEYTQILVAAADNVGSNQLQNIRRGLRGDSVVLMGKNTMMKRTIRMHAEKTGNTAFLNLIPLLQGNVGLIFTKGDLXXXXXXXXXXXXGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALL 708
            +V+ +KA  K  Y  K+ +L +E+ +  +  ADNVGS Q+QNIR  LRG +VVLMGKNTMM++ IR H E   N     L+P ++GNVG +FTKGDL             APAR G +AP+ V++P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V +++ GDKVG+SEA LL
Sbjct:    1 MVRENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLAVVLMGKNTMMRKAIRGHLEN--NPQLEKLLPHIKGNVGFVFTKGDLAEVRDKLLESKVRAPARPGAIAPLHVIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVPILKPGDKVGASEATLL 175          
The following BLAST results are available for this feature:
BLAST of FC931327 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 51
Match NameE-valueIdentityDescription
RLA0_SOYBN2.823e-7884.2760S acidic ribosomal protein P0 OS=Glycine max PE=... [more]
RLA01_ARATH8.212e-7883.1560S acidic ribosomal protein P0-1 OS=Arabidopsis t... [more]
RLA02_ARATH1.073e-7783.0560S acidic ribosomal protein P0-2 OS=Arabidopsis t... [more]
RLA03_ARATH3.121e-7782.4960S acidic ribosomal protein P0-3 OS=Arabidopsis t... [more]
RLA0_LUPLU4.506e-7683.1560S acidic ribosomal protein P0 OS=Lupinus luteus ... [more]
RLA0_ORYSJ9.396e-7476.4060S acidic ribosomal protein P0 OS=Oryza sativa su... [more]
RLA0_MAIZE9.723e-7175.8460S acidic ribosomal protein P0 OS=Zea mays GN=RP-... [more]
RLA0_CHERU4.826e-7076.9760S acidic ribosomal protein P0 OS=Chenopodium rub... [more]
RLA0_CERCA1.197e-4451.9860S acidic ribosomal protein P0 OS=Ceratitis capit... [more]
RLA0_DROME5.940e-4451.4160S acidic ribosomal protein P0 OS=Drosophila mela... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34103H10EF PostHarvP1 Citrus clementina cDNA clone C34103H10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931327 ID=FC931327|Name=FC931327|organism=Citrus clementina|type=EST|length=710bp
ATTCTAGGGTTTTTTCTTGTACACTTCTTTCACTCTCTTTGTATCTCGTT
GAGGTTAAAGAGACGGCAATTCCGCTGCTGTCCGCCTTGGCAAGCCGCTG
CTTCGTCTTGGCCCTCGATTTTGTATAAATTTACAACTTTTTACCACCAA
CAAAAGTAGAACCAAATCCACGAAATGGTAGTGAAAGCATCGAAGGCCGA
GAAGAAGATCGCGTACGACGCGAAGCTATGCCAGTTGCTGGAAGAGTACA
CCCAAATATTGGTGGCGGCCGCCGACAACGTGGGGTCCAATCAACTCCAG
AACATTCGTAGGGGTCTGCGTGGAGACTCCGTTGTGCTCATGGGAAAGAA
CACTATGATGAAGAGGACTATCAGAATGCACGCTGAGAAGACCGGTAACA
CTGCCTTTCTCAATCTCATCCCCCTCCTTCAGGGCAATGTTGGGTTGATT
TTCACAAAGGGTGATTTGAAGGAAGTGAAAGAGGAGGTTGCTAAGTACAA
GGTTGGAGCTCCTGCTCGTGTTGGTTTGGTTGCTCCAATTGATGTGGTTG
TTCCTCCCGGCAACACAGGTCTCGACCCCTCCCAGACCTCCTTCTTCCAG
GTGCTTAACATTCCCACCAAGATTAACAAGGGTACTGTTGAAATTATCAC
ACCTGTGGAGCTTATTAGGAAGGGTGACAAGGTGGGATCTTCTGAGGCAG
CCCTGCTTGC
back to top