FC931328

Overview
NameFC931328
Unique NameFC931328
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length749
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig11603 contig Ccv1_Contig11603:46..796. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931328 vs. ExPASy Swiss-Prot
Match: 3HBH_KLEOX (3-hydroxybenzoate 6-hydroxylase OS=Klebsiella oxytoca GN=mhbM PE=1 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 2.490e-11
Identity = 75/251 (29.88%), Postives = 108/251 (43.03%), Query Frame = 1
Query:    7 VIIGARIAGLATALALKRLGIKPLVLEKSDGLRGTGAAINFAPNAWLALDALG---VSHKLASIYDPVKRLFVTNLRTGATQETSLAGKSENGSGVRYIHRKKLLETLADEL---PDDTIHFSSKIAAINSETHDALSPVIIHLADGTIVKARVLIGCDGIHSTVARWLGLSEPLNAGR---SAGLGLAVFPEGHGLNKEVRLFVDAGMRAGYVPLK*YEIYWFLVCNCSAEGE-------SKGRILS*FK 711
            +I+G  I G ATAL+L R GIK ++LEK+  +   GA I   PNA+ ALD+LG   V+ + A   D +  +   N       ET  A +   G     IHR  +  T+ +     P      S+++  I     D    V +    G    A +LIGCDG  S V + L    P   G     A +  A  P+   +N  V L+        + PL+  + Y  +V   S + E       SK  +LS FK
Sbjct:    8 IIVGGGIGGAATALSLARQGIKVMLLEKAHEIGEIGAGIQLGPNAFSALDSLGVGEVARQRAVFTDHITMMDAVNGEEVVHIETGQAFRDHFGGPYAVIHRVDIHATVWEAALTHPAVEYRTSTQVVDIRQTADD----VTVFDDKGNSWTADILIGCDGGKSVVRQSLLGDSPRVTGHVVYRAVVDAADMPDDLRINAPV-LWAGPHCHLVHYPLRGGKQYNLVVTFHSRQQEEWGVRDGSKEEVLSYFK 253          
BLAST of FC931328 vs. ExPASy Swiss-Prot
Match: 3HBH1_PSEAC (3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 9.462e-11
Identity = 55/181 (30.39%), Postives = 84/181 (46.41%), Query Frame = 1
Query:    1 DVVIIGARIAGLATALALKRLGIKPLVLEKSDGLRGTGAAINFAPNAWLALDALGVSHKLASIYDPV-KRLFVTNLRTGATQETSLAGKSENGSGVRY--IHRKKLLETLADEL-PDDTIHFSSKIAAINSETHDALSPVIIHLADGTIVKARVLIGCDGIHSTV-ARWLGLSEPLNAGRS 528
            +++I GA I GL+ AL L R G++ +VLEK+  L   GA I  APNA+ ALDALG+          V K L++  +         LA +     G  Y  IHR      L +       +   +    ++ E        I+H  DG+ +   VL+G DG+ S V  + +G  +P  +G +
Sbjct:    4 NILIAGAGIGGLSAALGLARKGMRSIVLEKAPELGEIGAGIQLAPNAYHALDALGIGEVARQTGVHVDKLLWMDGMTDKEIASVPLANRFREFFGNPYAVIHRADFHGLLVEACHKTGLVEVRTNAEVVDYENFPDRVEAILH--DGSCINGAVLVGADGLWSNVRQKVIGDGDPRVSGHT 182          
The following BLAST results are available for this feature:
BLAST of FC931328 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
3HBH_KLEOX2.490e-1129.883-hydroxybenzoate 6-hydroxylase OS=Klebsiella oxyt... [more]
3HBH1_PSEAC9.462e-1130.393-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas a... [more]
back to top
Properties
Property NameValue
Genbank descriptionC34103H11EF PostHarvP1 Citrus clementina cDNA clone C34103H11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931328 ID=FC931328|Name=FC931328|organism=Citrus clementina|type=EST|length=749bp
GATGTTGTAATAATTGGAGCACGGATAGCAGGATTGGCAACGGCGTTGGC
TCTCAAGAGACTTGGAATTAAACCCTTGGTTTTAGAAAAATCGGACGGGC
TCCGAGGCACTGGTGCTGCGATAAATTTTGCCCCAAACGCTTGGCTTGCT
CTTGATGCTCTTGGTGTTTCTCACAAGCTTGCTTCCATTTATGATCCTGT
TAAGAGGTTGTTTGTAACAAATCTTAGAACTGGAGCAACTCAAGAGACGT
CCTTAGCTGGAAAATCTGAGAATGGATCTGGAGTCAGATACATACATCGC
AAAAAGTTACTAGAGACCTTGGCAGATGAGTTGCCAGATGACACAATCCA
TTTCTCTTCGAAGATTGCTGCAATTAATTCAGAAACACATGATGCTTTGT
CCCCAGTTATCATTCATTTGGCTGATGGTACTATAGTTAAAGCTAGGGTT
TTGATTGGATGTGATGGGATACACTCAACGGTGGCACGGTGGCTGGGACT
TTCGGAACCGTTAAATGCCGGCCGATCAGCCGGGCTTGGCTTGGCTGTGT
TTCCTGAAGGCCATGGGCTGAACAAAGAAGTAAGGCTATTTGTCGATGCG
GGCATGAGGGCTGGATATGTGCCTCTCAAATGATACGAGATCTATTGGTT
CCTCGTTTGTAATTGTTCCGCTGAAGGGGAAAGCAAGGGCAGAATCCTGA
GCTGATTCAAAAAGAGTACTCGAGAAGTATGCCAAGGTCTTACCCCCAT
back to top