FC931329

Overview
NameFC931329
Unique NameFC931329
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length671
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9398 contig Ccv1_Contig9398:100..771. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931329 vs. ExPASy Swiss-Prot
Match: BPS1_ARATH (Protein BPS1, chloroplastic OS=Arabidopsis thaliana GN=BPS1 PE=2 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 5.300e-52
Identity = 99/160 (61.88%), Postives = 124/160 (77.50%), Query Frame = 2
Query:  188 MSRPQDPHRPFFPFGNPFRMMSPKGSRLSPKLVSLLADFEETLAERLRKLMPKDKDDILNLSWMRLAMESLCETHNVIKDLITELELPVSDWDEKWIDVYLDISVNLLDICIAFSSVLTKVSQGHLLLQCVLHTLDSSSPTQFGRACPSLDTGGSTLVXR 667
            M+RPQDP R FFPFGNPF+ +S K S LS KL+ LL +FE  LA  + KL+PK+K DIL +SWM+ AMESLCETHN IK LIT+LELPVSDW++KW+DVYLDISV LLD+C AFSS LT+++QGHLLLQ  LH L+++SP    +A  SLD+    +V +
Sbjct:    1 MARPQDPPRGFFPFGNPFKNLSSKNSVLSSKLLPLLNNFETNLASSISKLVPKEKSDILTVSWMKQAMESLCETHNGIKTLITDLELPVSDWEDKWVDVYLDISVKLLDLCNAFSSELTRLNQGHLLLQFALHNLEANSPQNLSKAQSSLDSWKQHIVSK 160          
BLAST of FC931329 vs. ExPASy Swiss-Prot
Match: U496D_ORYSJ (UPF0496 protein 4 OS=Oryza sativa subsp. japonica GN=Os10g0513300 PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 4.209e-41
Identity = 89/154 (57.79%), Postives = 106/154 (68.83%), Query Frame = 2
Query:  188 MSRPQDPHRPFFPFGNPFRMMSPKGSRLSPKLVSLLADFEETLAERLRKLMPKDKDDILNLSWMRLAMESLCETHNVIKDLITELELPVSDWDEKWIDVYLDISVNLLDICIAFSSVLTKVSQGHLLLQCVLHTLDSS----SPTQFGRACPSL 637
            MSR     R FFP GNPFR+M P G+ LS KL  LLA +E+ LA  LRKL P+   D+L LSWMRLA++ L E H  I +LIT+LELPVSDWD+KW+D+YL+ SV LLDICIA SS L+++ QG LLLQ  LH L S     S  Q  RA PSL
Sbjct:    1 MSRAHGSPRSFFPVGNPFRVMFPGGAHLSRKLQELLASYEDALALSLRKLKPEAASDVLTLSWMRLAVDCLSELHTNIANLITDLELPVSDWDDKWVDIYLNSSVKLLDICIALSSELSRLDQGQLLLQYALHVLGSESGVPSQEQLKRAEPSL 154          
BLAST of FC931329 vs. ExPASy Swiss-Prot
Match: U496D_ORYSI (UPF0496 protein 4 OS=Oryza sativa subsp. indica GN=OsI_033149 PE=3 SV=2)

HSP 1 Score: 167.933 bits (424), Expect = 4.209e-41
Identity = 89/154 (57.79%), Postives = 106/154 (68.83%), Query Frame = 2
Query:  188 MSRPQDPHRPFFPFGNPFRMMSPKGSRLSPKLVSLLADFEETLAERLRKLMPKDKDDILNLSWMRLAMESLCETHNVIKDLITELELPVSDWDEKWIDVYLDISVNLLDICIAFSSVLTKVSQGHLLLQCVLHTLDSS----SPTQFGRACPSL 637
            MSR     R FFP GNPFR+M P G+ LS KL  LLA +E+ LA  LRKL P+   D+L LSWMRLA++ L E H  I +LIT+LELPVSDWD+KW+D+YL+ SV LLDICIA SS L+++ QG LLLQ  LH L S     S  Q  RA PSL
Sbjct:    1 MSRAHGSPRSFFPVGNPFRVMFPGGAHLSRKLQELLASYEDALALSLRKLKPEAASDVLTLSWMRLAVDCLSELHTNIANLITDLELPVSDWDDKWVDIYLNSSVKLLDICIALSSELSRLDQGQLLLQYALHVLGSESGVPSQEQLKRAEPSL 154          
The following BLAST results are available for this feature:
BLAST of FC931329 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
BPS1_ARATH5.300e-5261.88Protein BPS1, chloroplastic OS=Arabidopsis thalian... [more]
U496D_ORYSJ4.209e-4157.79UPF0496 protein 4 OS=Oryza sativa subsp. japonica ... [more]
U496D_ORYSI4.209e-4157.79UPF0496 protein 4 OS=Oryza sativa subsp. indica GN... [more]
back to top
Properties
Property NameValue
Genbank descriptionC34103H12EF PostHarvP1 Citrus clementina cDNA clone C34103H12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931329 ID=FC931329|Name=FC931329|organism=Citrus clementina|type=EST|length=671bp
TTCTTTAATCTTTGTGAAGAGAGAGGCTATTTTGTTTTTCTGCGTGATTG
TTTTTTTAGTTATCAAAGACGTGGAAATTAGGTTTAGGTTTAGTGACGGT
CTGGCATTAATTCTTTGTTAAGTATTTCGATTTAACCGAATAATCAGTTT
TTCGATCCACGATCTATTGTTAAGCAAATCCATCAAAATGAGTCGCCCCC
AGGATCCACACCGTCCTTTCTTCCCATTTGGAAATCCTTTTCGGATGATG
TCCCCCAAAGGTTCTCGTTTGTCTCCCAAGCTTGTATCTCTGTTGGCTGA
TTTTGAGGAGACCTTGGCAGAGAGGCTGAGAAAACTTATGCCGAAAGACA
AGGATGATATCCTCAACTTATCATGGATGAGACTGGCAATGGAGTCACTT
TGTGAGACTCACAATGTCATAAAAGACCTTATAACTGAGTTGGAGCTTCC
TGTAAGTGACTGGGATGAGAAATGGATAGACGTGTACTTAGACATCAGTG
TAAACTTGCTTGATATATGCATTGCTTTTAGCTCTGTTCTCACGAAGGTC
AGCCAAGGCCACCTATTGCTTCAGTGTGTCTTGCACACTTTGGATTCTTC
CTCTCCAACACAGTTTGGGCGAGCCTGTCCTTCTCTTGATACTGGAGGGA
GCACATTAGTTCNAAGAACCC
back to top