FC931331

Overview
NameFC931331
Unique NameFC931331
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length705
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9351 contig Ccv1_Contig9351:3..707. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931331 vs. ExPASy Swiss-Prot
Match: TRPD_ARATH (Anthranilate phosphoribosyltransferase, chloroplastic OS=Arabidopsis thaliana GN=PAT1 PE=2 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 1.808e-61
Identity = 123/181 (67.96%), Postives = 144/181 (79.56%), Query Frame = 2
Query:  152 TAIQTPQPAVSDNTRPQTPCFNELIDCLISRVDLTEAEAQASLDYLLNEADEALISAFFVLLRAKGETFGEIVGLARAMIKYATKVEGLGDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQXXXXXXXXXXXXDVLEALGVVIDLDPEGVRRCVDEAGIGFMMSTKYHPAMKFVRP 694
            +A +   PA ++ +      FN+LI+ LI RVDL+E EA++SL++LLNEA+EALISAF VLLRAKGET+ EIVGLARAM+K+A KVEGL DAVDIVGTGGDGANTVNISTG+SILAAACGAKVAKQ            DVLEALGVV+DL PEG++RCV+E GIGFMMS  YHPAMK V P
Sbjct:   88 SAAEALPPACANASPSSIKSFNQLIETLIDRVDLSETEAESSLEFLLNEANEALISAFLVLLRAKGETYEEIVGLARAMMKHARKVEGLVDAVDIVGTGGDGANTVNISTGSSILAAACGAKVAKQGNRSSSSACGSADVLEALGVVLDLGPEGIKRCVEEGGIGFMMSPMYHPAMKIVGP 268          
BLAST of FC931331 vs. ExPASy Swiss-Prot
Match: TRPD_ACIC1 (Anthranilate phosphoribosyltransferase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=trpD PE=3 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 3.214e-34
Identity = 78/162 (48.15%), Postives = 110/162 (67.90%), Query Frame = 2
Query:  203 TPCFNELIDCLISRVDLTEAEAQASLDYLLN-EADEALISAFFVLLRAKGETFGEIVGLARAMIKYATKVEGLGDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQXXXXXXXXXXXXDVLEALGVVIDLDPEGVRRCVDEAGIGFMMSTKYHPAMKF 685
            TP + E++  L++R DLTEAEA  ++  +++ EA +A I+AF V LRAKGE+  E+ GL+  M+  A  V  +G+A+DIVG+GGD A+TVNIST A+I+AAA G  VAK             D+LEALGV IDLD  GV RC++ AGIGF  +  +HP++++
Sbjct:    5 TPSWPEVLSALLARRDLTEAEAAWAMHQIMSGEATDAQIAAFAVALRAKGESAEEVSGLSSVMLALAAPVPPIGEALDIVGSGGDRAHTVNISTMAAIVAAATGVVVAKHGNRAASSACGSADLLEALGVAIDLDGAGVARCIERAGIGFCFAPVFHPSLRY 166          
BLAST of FC931331 vs. ExPASy Swiss-Prot
Match: TRPD_CHLAD (Anthranilate phosphoribosyltransferase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=trpD PE=3 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 5.131e-32
Identity = 77/160 (48.12%), Postives = 99/160 (61.88%), Query Frame = 2
Query:  218 ELIDCLISRVDLTEAEAQASLDYLLN-EADEALISAFFVLLRAKGETFGEIVGLARAMIKYATKVEGLGDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQXXXXXXXXXXXXDVLEALGVVIDLDPEGVRRCVDEAGIGFMMSTKYHPAMKFVRP 694
            E I  +++R DLT+AEA + ++ ++N  A  A I+AF   L  KGET  EI G+A  M + AT V   G  +D  GTGGDGA+T NIST A+ +AA  G  VAK             DVLE LGV I+LD EGV RC+ +AGIGFM + K+HPAM+F  P
Sbjct:    5 EAIAAVVARRDLTQAEAASVMEEIMNGTATPAQIAAFLTALHIKGETDAEIAGMAAVMREKATHVYFDGPVIDTCGTGGDGAHTFNISTTAAFVAAGAGLTVAKHGNRAMSSVCGSADVLEGLGVQIELDAEGVARCLRDAGIGFMFAPKFHPAMRFAGP 164          
BLAST of FC931331 vs. ExPASy Swiss-Prot
Match: TRPD_CHLSY (Anthranilate phosphoribosyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=trpD PE=3 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.143e-31
Identity = 77/160 (48.12%), Postives = 98/160 (61.25%), Query Frame = 2
Query:  218 ELIDCLISRVDLTEAEAQASLDYLLN-EADEALISAFFVLLRAKGETFGEIVGLARAMIKYATKVEGLGDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQXXXXXXXXXXXXDVLEALGVVIDLDPEGVRRCVDEAGIGFMMSTKYHPAMKFVRP 694
            E I  +++R DLT+AEA + ++ +++  A  A I AF   L  KGET  EI G+A  M + AT V   G  +D  GTGGDGA+T NIST A+ +AA  G  VAK             DVLE LGV I+LD EGV RC+ EAGIGFM + K+HPAM+F  P
Sbjct:    5 EAIAAVVARRDLTQAEAASVMEEIMSGTATPAQIGAFLTALHMKGETDAEIAGMAAVMREKATHVYFDGPVIDTCGTGGDGAHTFNISTTAAFVAAGAGLTVAKHGNRAMSSVCGSADVLEGLGVQIELDAEGVARCLREAGIGFMFAPKFHPAMRFAGP 164          
BLAST of FC931331 vs. ExPASy Swiss-Prot
Match: TRPD_CHLAA (Anthranilate phosphoribosyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=trpD PE=3 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.143e-31
Identity = 77/160 (48.12%), Postives = 98/160 (61.25%), Query Frame = 2
Query:  218 ELIDCLISRVDLTEAEAQASLDYLLN-EADEALISAFFVLLRAKGETFGEIVGLARAMIKYATKVEGLGDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQXXXXXXXXXXXXDVLEALGVVIDLDPEGVRRCVDEAGIGFMMSTKYHPAMKFVRP 694
            E I  +++R DLT+AEA + ++ +++  A  A I AF   L  KGET  EI G+A  M + AT V   G  +D  GTGGDGA+T NIST A+ +AA  G  VAK             DVLE LGV I+LD EGV RC+ EAGIGFM + K+HPAM+F  P
Sbjct:    5 EAIAAVVARRDLTQAEAASVMEEIMSGTATPAQIGAFLTALHMKGETDAEIAGMAAVMREKATHVYFDGPVIDTCGTGGDGAHTFNISTTAAFVAAGAGLTVAKHGNRAMSSVCGSADVLEGLGVQIELDAEGVARCLREAGIGFMFAPKFHPAMRFAGP 164          
BLAST of FC931331 vs. ExPASy Swiss-Prot
Match: TRPD_CHLFF (Anthranilate phosphoribosyltransferase OS=Chlamydophila felis (strain Fe/C-56) GN=trpD PE=3 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 2.156e-30
Identity = 70/157 (44.59%), Postives = 101/157 (64.33%), Query Frame = 2
Query:  224 IDCLISRVDLTEAEAQASLDYLLNEADEALISAFFVLLRAKGETFGEIVGLARAMIKYATKVEGLGDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQXXXXXXXXXXXXDVLEALGVVIDLDPEGVRRCVDEAGIGFMMSTKYHPAMKFVRP 694
            +  ++++  LT  EA++  + +LN +D   I+AF  +L+ +GET  EI G+  A+ K AT V+    A+DIVGTGGD ANTVNISTG++IL+AACG  +AK             DVLEALG+ I++ PE +  C+ E GIGFM +  YHP++K + P
Sbjct:    6 LQSIMNQSHLTYDEAESVTNLMLNGSDPHQIAAFLAVLKYRGETPTEIAGMVSALQKQATSVDLPFPALDIVGTGGDLANTVNISTGSAILSAACGIPIAKHGNRSVSSQSGSADVLEALGIEIEMTPEELLSCIQEVGIGFMFAPIYHPSLKKLAP 162          
BLAST of FC931331 vs. ExPASy Swiss-Prot
Match: TRPD_CHLCV (Anthranilate phosphoribosyltransferase OS=Chlamydophila caviae GN=trpD PE=3 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.816e-30
Identity = 71/157 (45.22%), Postives = 99/157 (63.06%), Query Frame = 2
Query:  224 IDCLISRVDLTEAEAQASLDYLLNEADEALISAFFVLLRAKGETFGEIVGLARAMIKYATKVEGLGDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQXXXXXXXXXXXXDVLEALGVVIDLDPEGVRRCVDEAGIGFMMSTKYHPAMKFVRP 694
            +  ++++  LT  E ++  + +LN AD   I+AF  +L+ +GET  E+ G+  A+ K AT V     A+DIVGTGGD ANTVNISTG++ILAAACG  +AK             DVLEALG+ I++ PE +  CV E GIGFM +  YHP++K + P
Sbjct:    6 LQSIMNQSHLTYDEVESVTNLMLNGADPHQIAAFLAVLKYRGETPTEVAGMISALQKQATPVNLPFPALDIVGTGGDLANTVNISTGSAILAAACGIPIAKHGNRSVSSQSGSADVLEALGIEIEMSPEELLSCVQEVGIGFMFAPIYHPSLKKLAP 162          
BLAST of FC931331 vs. ExPASy Swiss-Prot
Match: TRPD_SACEN (Anthranilate phosphoribosyltransferase OS=Saccharopolyspora erythraea (strain NRRL 23338) GN=trpD PE=3 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 4.803e-30
Identity = 74/155 (47.74%), Postives = 99/155 (63.87%), Query Frame = 2
Query:  221 LIDCLISRVDLTEAEAQASLDYLLN-EADEALISAFFVLLRAKGETFGEIVGLARAMIKYATKVEGLGDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQXXXXXXXXXXXXDVLEALGVVIDLDPEGVRRCVDEAGIGFMMSTKYHPAMK 682
            L+  L++  DL+  +   ++D ++  EA  A ++AF V LRAKGET  E+ G+A AM+ ++  +E    AVDIVGTGGD + +VNIST ASI+ AA G  V K             DVLEALGV IDL PEGVRRCV++ GIGF  +  +HPAM+
Sbjct:   11 LLGHLVAGNDLSAEDTAWAMDLVMTGEATPARVAAFVVALRAKGETPAEVRGMADAMLSHSRPLEIRRRAVDIVGTGGDRSGSVNISTMASIVVAAAGVPVVKHGNRAASSKCGTADVLEALGVAIDLPPEGVRRCVEDLGIGFCFAPVFHPAMR 165          
BLAST of FC931331 vs. ExPASy Swiss-Prot
Match: TRPD_ROSCS (Anthranilate phosphoribosyltransferase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=trpD PE=3 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 6.935e-29
Identity = 71/150 (47.33%), Postives = 89/150 (59.33%), Query Frame = 2
Query:  248 DLTEAEAQASLDYLLNE-ADEALISAFFVLLRAKGETFGEIVGLARAMIKYATKVEGLGDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQXXXXXXXXXXXXDVLEALGVVIDLDPEGVRRCVDEAGIGFMMSTKYHPAMKFVRP 694
            DLTE +A  +++ ++   A  A ++A    L  KGET  EI G+AR M   A  V   G  +D  GTGGD A T NIST A+ +AA  GA VAK             DVLE LGV IDLD  GV RC+++AGIGFM + K+HPAM+FV P
Sbjct:   15 DLTEEQAAEAMEEIMTGVATPAQVAALLTALHLKGETDAEIAGMARVMRAKAIPVHFDGPLLDTCGTGGDSAGTFNISTTAAFIAAGAGATVAKHGNRAMSSVCGSADVLEGLGVTIDLDAAGVARCLEQAGIGFMFAQKFHPAMRFVGP 164          
BLAST of FC931331 vs. ExPASy Swiss-Prot
Match: TRPD_HERA2 (Anthranilate phosphoribosyltransferase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=trpD PE=3 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 6.935e-29
Identity = 72/160 (45.00%), Postives = 96/160 (60.00%), Query Frame = 2
Query:  218 ELIDCLISRVDLTEAEAQASLDYLLN-EADEALISAFFVLLRAKGETFGEIVGLARAMIKYATKVEGLGDAVDIVGTGGDGANTVNISTGASILAAACGAKVAKQXXXXXXXXXXXXDVLEALGVVIDLDPEGVRRCVDEAGIGFMMSTKYHPAMKFVRP 694
            + I  + +R DL++ +A A ++ ++N EA  A I+A    L  KGET  EI G+A+ M   +  V   G  VD  GTGGD +NT NIST A+ +AA  GA VAK             DVLE LGV I+LD EGV RC+ +AGIGFM + K+HPAM++  P
Sbjct:    5 DAIITVTNRTDLSQDDAAAVMEQMMNGEATPAQIAALLTALHFKGETDAEIAGMAQVMRAKSLAVPHDGGVVDTCGTGGDHSNTFNISTTAAFVAAGAGATVAKHGNRAMSSKCGSADVLEGLGVNIELDAEGVARCLRQAGIGFMFAPKFHPAMRYAGP 164          
The following BLAST results are available for this feature:
BLAST of FC931331 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
TRPD_ARATH1.808e-6167.96Anthranilate phosphoribosyltransferase, chloroplas... [more]
TRPD_ACIC13.214e-3448.15Anthranilate phosphoribosyltransferase OS=Acidothe... [more]
TRPD_CHLAD5.131e-3248.13Anthranilate phosphoribosyltransferase OS=Chlorofl... [more]
TRPD_CHLSY1.143e-3148.13Anthranilate phosphoribosyltransferase OS=Chlorofl... [more]
TRPD_CHLAA1.143e-3148.13Anthranilate phosphoribosyltransferase OS=Chlorofl... [more]
TRPD_CHLFF2.156e-3044.59Anthranilate phosphoribosyltransferase OS=Chlamydo... [more]
TRPD_CHLCV2.816e-3045.22Anthranilate phosphoribosyltransferase OS=Chlamydo... [more]
TRPD_SACEN4.803e-3047.74Anthranilate phosphoribosyltransferase OS=Saccharo... [more]
TRPD_ROSCS6.935e-2947.33Anthranilate phosphoribosyltransferase OS=Roseifle... [more]
TRPD_HERA26.935e-2945.00Anthranilate phosphoribosyltransferase OS=Herpetos... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34104A02EF PostHarvP1 Citrus clementina cDNA clone C34104A02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931331 ID=FC931331|Name=FC931331|organism=Citrus clementina|type=EST|length=705bp
GAACACAATGACAATGAGAGCGTTGTTGAATTTAACTGCAGTTTCTTCCT
CTCCATTTAATAATAATCACCCAAATCACCGGCCTTCCTTACCGTCGCTT
CGAAACTGTGGATTTACGACTGCGGGTAGTAATCCGAGATGCAGAGAATT
AACTGCTATTCAAACCCCTCAGCCGGCTGTTTCTGATAATACTCGCCCTC
AAACGCCCTGCTTTAATGAGTTGATCGATTGCTTGATAAGTCGAGTGGAT
TTAACGGAGGCGGAGGCTCAAGCTTCGCTGGATTATTTGTTGAATGAAGC
TGATGAGGCCTTGATTAGTGCTTTTTTTGTTTTGCTCAGAGCCAAAGGAG
AAACATTTGGAGAGATTGTGGGATTGGCCAGGGCGATGATAAAGTATGCT
ACGAAGGTGGAAGGGCTGGGTGATGCAGTTGATATTGTGGGTACAGGAGG
TGATGGTGCAAACACAGTGAACATTTCAACTGGTGCTTCAATTCTTGCTG
CAGCTTGTGGTGCAAAAGTTGCCAAGCAAGGGAGTCGGTCTAGTTCTTCT
GCATGTGGAAGTGCTGATGTGTTAGAAGCTTTGGGTGTCGTTATTGACTT
GGACCCAGAGGGTGTAAGAAGGTGTGTGGATGAGGCAGGAATTGGTTTCA
TGATGTCGACAAAGTATCACCCTGCAATGAAGTTTGTCAGGCCANGTGAG
GAAAA
back to top