FC931384

Overview
NameFC931384
Unique NameFC931384
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length744
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15321 contig Ccv1_Contig15321:1..745. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931384 vs. ExPASy Swiss-Prot
Match: R10A3_ARATH (60S ribosomal protein L10a-3 OS=Arabidopsis thaliana GN=RPL10AC PE=2 SV=1)

HSP 1 Score: 320.472 bits (820), Expect = 3.791e-93
Identity = 164/196 (83.67%), Postives = 173/196 (88.27%), Query Frame = 1
Query:   64 MSKLQSDALREAISSIVQYSKETNKRNFTETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKVCMLGDAQHVEEAEKIGLDYMDVEGXXXXXXXXXXXXXXXXXYHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKK 651
            MSKLQS+A+REAISSI+ + KET  RNFTETIELQIGLKNYDPQKDKRFSGSVKLPH+PRPKMK+CMLGDAQHVEEAEKIGL+ MDVE                  +HAFLASESVIKQIPRLLGPGLNKAGKFPTLV+HQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKK
Sbjct:    1 MSKLQSEAVREAISSIITHCKETKPRNFTETIELQIGLKNYDPQKDKRFSGSVKLPHVPRPKMKICMLGDAQHVEEAEKIGLESMDVEALKKLNKNKKLVKKLAKKFHAFLASESVIKQIPRLLGPGLNKAGKFPTLVSHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKK 196          

HSP 2 Score: 43.1282 bits (100), Expect = 3.791e-93
Identity = 17/25 (68.00%), Postives = 21/25 (84.00%), Query Frame = 3
Query:  639 IVEENWQNVRCLYLKSTMGPSTASF 713
            ++++NWQNVRCLYLKSTMGP    F
Sbjct:  193 LLKKNWQNVRCLYLKSTMGPPNRVF 217          
BLAST of FC931384 vs. ExPASy Swiss-Prot
Match: R10A1_ARATH (60S ribosomal protein L10a-1 OS=Arabidopsis thaliana GN=RPL10AA PE=2 SV=1)

HSP 1 Score: 309.686 bits (792), Expect = 8.452e-90
Identity = 162/196 (82.65%), Postives = 170/196 (86.73%), Query Frame = 1
Query:   64 MSKLQSDALREAISSIVQYSKETNKRNFTETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKVCMLGDAQHVEEAEKIGLDYMDVEGXXXXXXXXXXXXXXXXXYHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKK 651
            MSKLQS+A+REAI++I   S E  KRNF ETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMK+CMLGDAQHVEEAEK+GL+ MDVE                  YHAFLASESVIKQIPRLLGPGLNKAGKFPTLV+HQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKK
Sbjct:    1 MSKLQSEAVREAITTITGKS-EAKKRNFVETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKICMLGDAQHVEEAEKMGLENMDVESLKKLNKNKKLVKKLAKKYHAFLASESVIKQIPRLLGPGLNKAGKFPTLVSHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKK 195          

HSP 2 Score: 42.743 bits (99), Expect = 8.452e-90
Identity = 17/25 (68.00%), Postives = 21/25 (84.00%), Query Frame = 3
Query:  639 IVEENWQNVRCLYLKSTMGPSTASF 713
            ++++NWQNVRCLYLKSTMGP    F
Sbjct:  192 LLKKNWQNVRCLYLKSTMGPPQRIF 216          
BLAST of FC931384 vs. ExPASy Swiss-Prot
Match: R10A2_ARATH (60S ribosomal protein L10a-2 OS=Arabidopsis thaliana GN=RPL10AB PE=2 SV=1)

HSP 1 Score: 306.22 bits (783), Expect = 9.246e-89
Identity = 159/196 (81.12%), Postives = 170/196 (86.73%), Query Frame = 1
Query:   64 MSKLQSDALREAISSIVQYSKETNKRNFTETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKVCMLGDAQHVEEAEKIGLDYMDVEGXXXXXXXXXXXXXXXXXYHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKK 651
            MSKLQS+A+REAI++I   S+E  KRNF ET+ELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMK+CMLGDAQHVEEAEK+GL  MDVE                  YHAFLASESVIKQIPRLLGPGLNKAGKFPTLV+HQESLE+KVNETKATVKFQLKKVLCMGVAVGNLSMEEKQ+FQNVQMSVNFLVSLLKK
Sbjct:    1 MSKLQSEAVREAITTIKGKSEE-KKRNFVETVELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKICMLGDAQHVEEAEKMGLSNMDVEALKKLNKNKKLVKKLAKSYHAFLASESVIKQIPRLLGPGLNKAGKFPTLVSHQESLEAKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQLFQNVQMSVNFLVSLLKK 195          

HSP 2 Score: 42.743 bits (99), Expect = 9.246e-89
Identity = 17/25 (68.00%), Postives = 21/25 (84.00%), Query Frame = 3
Query:  639 IVEENWQNVRCLYLKSTMGPSTASF 713
            ++++NWQNVRCLYLKSTMGP    F
Sbjct:  192 LLKKNWQNVRCLYLKSTMGPPQRIF 216          
BLAST of FC931384 vs. ExPASy Swiss-Prot
Match: RL10A_SPOFR (60S ribosomal protein L10a OS=Spodoptera frugiperda GN=RpL10A PE=2 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 5.386e-65
Identity = 117/195 (60.00%), Postives = 148/195 (75.90%), Query Frame = 1
Query:   67 SKLQSDALREAISSIVQYSKETNKRNFTETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKVCMLGDAQHVEEAEKIGLDYMDVEGXXXXXXXXXXXXXXXXXYHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKK 651
            SK+  D L E +++++Q SK+  KRNF ET+ELQIGLKNYDPQKDKRFSG+VKL +IPRPKM+VC+LGD QH +EA+ + +  MD E                  Y AFLASES+IKQIPRLLGPGLNKAGKFP L++HQES+  K++E KAT+KFQ+KKVLC+ VAVG++ M   ++ QNV +S+NFLVSLLKK
Sbjct:    3 SKVSRDTLYECVNAVLQASKD-KKRNFLETVELQIGLKNYDPQKDKRFSGTVKLKYIPRPKMQVCVLGDQQHCDEAKSLTVPCMDAEALKKLNKNKKLVKKLAKKYDAFLASESLIKQIPRLLGPGLNKAGKFPGLLSHQESMTQKIDEVKATIKFQMKKVLCLSVAVGHVDMTPDELAQNVHLSINFLVSLLKK 196          

HSP 2 Score: 33.8834 bits (76), Expect = 5.386e-65
Identity = 12/20 (60.00%), Postives = 19/20 (95.00%), Query Frame = 3
Query:  639 IVEENWQNVRCLYLKSTMGP 698
            +++++WQNVR L++KSTMGP
Sbjct:  193 LLKKHWQNVRSLHMKSTMGP 212          
BLAST of FC931384 vs. ExPASy Swiss-Prot
Match: R10AB_DROME (60S ribosomal protein L10a-2 OS=Drosophila melanogaster GN=RpL10Ab PE=1 SV=2)

HSP 1 Score: 235.343 bits (599), Expect = 7.023e-65
Identity = 116/195 (59.49%), Postives = 146/195 (74.87%), Query Frame = 1
Query:   67 SKLQSDALREAISSIVQYSKETNKRNFTETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKVCMLGDAQHVEEAEKIGLDYMDVEGXXXXXXXXXXXXXXXXXYHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKK 651
            SK+  D L E ++ +++ S +  KR F ET+ELQIGLKNYDPQKDKRFSG+VKL HIPRPKMKVC+LGD QH +EA+   +D+MD E                  Y AFLASES+IKQIPRLLGPGLNKAGKFP L++HQES+  K+ E K+T+KFQ+KKVLC+ VAVG++ M+  ++ QNV +S+NFLVSLLKK
Sbjct:    3 SKVSRDTLYEGVNGLLEASAK-KKRGFLETVELQIGLKNYDPQKDKRFSGTVKLKHIPRPKMKVCILGDQQHCDEAKANNVDFMDAEALKKLNKNKKLVKKLAKSYDAFLASESLIKQIPRLLGPGLNKAGKFPALLSHQESMIGKIEEVKSTIKFQMKKVLCLSVAVGHVGMKSDELAQNVNLSINFLVSLLKK 196          

HSP 2 Score: 33.8834 bits (76), Expect = 7.023e-65
Identity = 12/20 (60.00%), Postives = 19/20 (95.00%), Query Frame = 3
Query:  639 IVEENWQNVRCLYLKSTMGP 698
            ++++NWQNVR L++KS+MGP
Sbjct:  193 LLKKNWQNVRSLHVKSSMGP 212          
BLAST of FC931384 vs. ExPASy Swiss-Prot
Match: RL10A_XENLA (60S ribosomal protein L10a OS=Xenopus laevis GN=rpl10a PE=2 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 1.849e-62
Identity = 110/195 (56.41%), Postives = 145/195 (74.36%), Query Frame = 1
Query:   67 SKLQSDALREAISSIVQYSKETNKRNFTETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKVCMLGDAQHVEEAEKIGLDYMDVEGXXXXXXXXXXXXXXXXXYHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKK 651
            SK+  D L EA+  ++Q SK+  KR F ET+ELQI LKNYDPQKDKRFSG+V+L   PRPK  +C+LGD QH +EA+ + L +MD+E                  Y AFLASES+IKQIPR+LGPGLNKAGKFP+L+TH E+L +KV+E K+T+KFQ+KKVLC+ VAVG++ + E+++  N+ +S+NFLVSLLKK
Sbjct:    3 SKVSRDTLYEAVREVLQGSKK-KKRKFLETVELQISLKNYDPQKDKRFSGTVRLKSTPRPKFSLCVLGDQQHCDEAKAVDLPHMDIEALKKLNKNKKLVKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENLVAKVDEVKSTIKFQMKKVLCLAVAVGHVKLTEEELVYNIHLSINFLVSLLKK 196          

HSP 2 Score: 35.4242 bits (80), Expect = 1.849e-62
Identity = 13/19 (68.42%), Postives = 18/19 (94.74%), Query Frame = 3
Query:  639 IVEENWQNVRCLYLKSTMG 695
            ++++NWQNVR LY+KSTMG
Sbjct:  193 LLKKNWQNVRALYIKSTMG 211          
BLAST of FC931384 vs. ExPASy Swiss-Prot
Match: RL10A_DANRE (60S ribosomal protein L10a OS=Danio rerio GN=rpl10a PE=2 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 6.970e-62
Identity = 112/196 (57.14%), Postives = 141/196 (71.94%), Query Frame = 1
Query:   64 MSKLQSDALREAISSIVQYSKETNKRNFTETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKVCMLGDAQHVEEAEKIGLDYMDVEGXXXXXXXXXXXXXXXXXYHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKK 651
            MSK+  D L EA+   VQ      KR F ET+ELQI LKNYDPQKDKRFSG+V+L   PRPK  VC+LGD QH +EA+   L +MD+E                  Y AFLASES+IKQIPR+LGPGLNKAGKFP+L+TH E+L +KV+E K+T+KFQ+KKVLC+ VAVG++ M E+++  N+ ++VNFLVSLLKK
Sbjct:    1 MSKVSRDTLYEAVKE-VQAGSRRKKRKFLETVELQISLKNYDPQKDKRFSGTVRLKTTPRPKFSVCVLGDQQHCDEAKAAELPHMDIEALKKLNKNKKLVKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENLGTKVDEVKSTIKFQMKKVLCLAVAVGHVKMSEEELVYNIHLAVNFLVSLLKK 195          

HSP 2 Score: 35.4242 bits (80), Expect = 6.970e-62
Identity = 13/19 (68.42%), Postives = 18/19 (94.74%), Query Frame = 3
Query:  639 IVEENWQNVRCLYLKSTMG 695
            ++++NWQNVR LY+KSTMG
Sbjct:  192 LLKKNWQNVRALYIKSTMG 210          
BLAST of FC931384 vs. ExPASy Swiss-Prot
Match: RL10A_NEUCR (60S ribosomal protein L10a OS=Neurospora crassa GN=rpl-10a PE=3 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 2.015e-61
Identity = 109/196 (55.61%), Postives = 147/196 (75.00%), Query Frame = 1
Query:   64 MSKLQSDALREAISSIVQYSKETNKRNFTETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKVCMLGDAQHVEEAEKIGLDYMDVEGXXXXXXXXXXXXXXXXXYHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKK 651
            MSK+   A+R+ ++ +++YS ET KRNF ET+ELQIGLKNYDPQ+DKRFSG+++LP IPRP M +C+LGD   ++ A+  G+D M V+                  Y AF+ASE++IKQIPRLLGPGL+KAGKFPT V+H + L  K+NE K+T+KFQLKKVLCMGVAVGN+ M ++Q+  N+ +++N+LVSLLKK
Sbjct:    1 MSKISVAAVRQHVTDLLEYSNETKKRNFLETVELQIGLKNYDPQRDKRFSGTIRLPSIPRPNMSICILGDQHDIDRAKHGGVDAMSVDDLKKLNKNKKLIKKLARKYDAFVASEALIKQIPRLLGPGLSKAGKFPTPVSHSDDLTGKLNEVKSTIKFQLKKVLCMGVAVGNVGMTQEQLVGNIMLAINYLVSLLKK 196          

HSP 2 Score: 25.7942 bits (55), Expect = 2.015e-61
Identity = 9/20 (45.00%), Postives = 15/20 (75.00%), Query Frame = 3
Query:  639 IVEENWQNVRCLYLKSTMGP 698
            ++++ WQNV  L +K+TM P
Sbjct:  193 LLKKGWQNVGSLTIKATMSP 212          
BLAST of FC931384 vs. ExPASy Swiss-Prot
Match: RL10A_ICTPU (60S ribosomal protein L10a OS=Ictalurus punctatus GN=rpl10a PE=2 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 1.683e-60
Identity = 110/196 (56.12%), Postives = 141/196 (71.94%), Query Frame = 1
Query:   64 MSKLQSDALREAISSIVQYSKETNKRNFTETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKVCMLGDAQHVEEAEKIGLDYMDVEGXXXXXXXXXXXXXXXXXYHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKK 651
            MSK+  D L EA+   VQ    + +R F ET+ELQI LKNYDPQKDKRFSG+V+L   PRPK  VC+LGD QH +EA+   + +MD+E                  Y AFLASES+IKQIPR+LGPGLNKAGKFP+L+TH E+L +KV+E K+T+KFQ+KKVLC+ VAVG++ M E ++  N+ ++VNFLVSLLKK
Sbjct:    1 MSKVSRDTLYEAVRE-VQAGSISKRRKFLETVELQISLKNYDPQKDKRFSGTVRLKTTPRPKFSVCVLGDQQHCDEAKAAEIPHMDIEALKKLNKNKKMVKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENLNTKVDEVKSTIKFQMKKVLCLAVAVGHVRMSEDELVYNIHLAVNFLVSLLKK 195          

HSP 2 Score: 33.8834 bits (76), Expect = 1.683e-60
Identity = 12/19 (63.16%), Postives = 18/19 (94.74%), Query Frame = 3
Query:  639 IVEENWQNVRCLYLKSTMG 695
            ++++NWQNVR LY+KS+MG
Sbjct:  192 LLKKNWQNVRALYIKSSMG 210          
BLAST of FC931384 vs. ExPASy Swiss-Prot
Match: RL10A_RAT (60S ribosomal protein L10a OS=Rattus norvegicus GN=Rpl10a PE=1 SV=2)

HSP 1 Score: 219.164 bits (557), Expect = 1.683e-60
Identity = 105/195 (53.85%), Postives = 142/195 (72.82%), Query Frame = 1
Query:   67 SKLQSDALREAISSIVQYSKETNKRNFTETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKVCMLGDAQHVEEAEKIGLDYMDVEGXXXXXXXXXXXXXXXXXYHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKK 651
            SK+  D L EA+  ++ +  +  +R F ET+ELQI LKNYDPQKDKRFSG+V+L   PRPK  VC+LGD QH +EA+ + + +MD+E                  Y AFLASES+IKQIPR+LGPGLNKAGKFP+L+TH E++ +KV+E K+T+KFQ+KKVLC+ VAVG++ M + ++  N+ ++VNFLVSLLKK
Sbjct:    3 SKVSRDTLYEAVREVL-HGNQRKRRKFLETVELQISLKNYDPQKDKRFSGTVRLKSTPRPKFSVCVLGDQQHCDEAKAVDIPHMDIEALKKLNKNKKLVKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTDDELVYNIHLAVNFLVSLLKK 196          

HSP 2 Score: 35.4242 bits (80), Expect = 1.683e-60
Identity = 13/19 (68.42%), Postives = 18/19 (94.74%), Query Frame = 3
Query:  639 IVEENWQNVRCLYLKSTMG 695
            ++++NWQNVR LY+KSTMG
Sbjct:  193 LLKKNWQNVRALYIKSTMG 211          
The following BLAST results are available for this feature:
BLAST of FC931384 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 37
Match NameE-valueIdentityDescription
R10A3_ARATH3.791e-9383.6760S ribosomal protein L10a-3 OS=Arabidopsis thalia... [more]
R10A1_ARATH8.452e-9082.6560S ribosomal protein L10a-1 OS=Arabidopsis thalia... [more]
R10A2_ARATH9.246e-8981.1260S ribosomal protein L10a-2 OS=Arabidopsis thalia... [more]
RL10A_SPOFR5.386e-6560.0060S ribosomal protein L10a OS=Spodoptera frugiperd... [more]
R10AB_DROME7.023e-6559.4960S ribosomal protein L10a-2 OS=Drosophila melanog... [more]
RL10A_XENLA1.849e-6256.4160S ribosomal protein L10a OS=Xenopus laevis GN=rp... [more]
RL10A_DANRE6.970e-6257.1460S ribosomal protein L10a OS=Danio rerio GN=rpl10... [more]
RL10A_NEUCR2.015e-6155.6160S ribosomal protein L10a OS=Neurospora crassa GN... [more]
RL10A_ICTPU1.683e-6056.1260S ribosomal protein L10a OS=Ictalurus punctatus ... [more]
RL10A_RAT1.683e-6053.8560S ribosomal protein L10a OS=Rattus norvegicus GN... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34104E09EF PostHarvP1 Citrus clementina cDNA clone C34104E09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931384 ID=FC931384|Name=FC931384|organism=Citrus clementina|type=EST|length=744bp
GTAGGGTTTCTTTTTCGTCTTCGAAGAAAAAAAAATCTGTAAAGGACTCC
AAGCGCTTCAATCATGAGCAAGCTTCAGAGTGATGCACTGAGAGAGGCCA
TCTCTAGTATTGTGCAATACTCTAAGGAGACAAATAAGAGGAACTTCACC
GAGACTATTGAGCTTCAGATTGGTCTCAAGAACTATGATCCACAAAAGGA
CAAGCGTTTCAGTGGCTCTGTTAAGTTGCCTCACATTCCCCGCCCCAAGA
TGAAGGTCTGCATGCTTGGTGATGCTCAACATGTTGAAGAGGCCGAGAAG
ATTGGTTTGGACTACATGGATGTTGAAGGATTGAAAAAATTGAACAAGAA
CAAGAAATTGGTGAAGAAACTTGCCAAGAAATATCATGCTTTCTTGGCAT
CAGAGTCTGTCATCAAGCAGATTCCTCGTTTGTTGGGTCCTGGTCTCAAC
AAGGCAGGAAAGTTCCCTACCCTTGTTACTCACCAAGAATCCCTGGAGTC
CAAAGTCAACGAGACTAAGGCAACAGTGAAGTTCCAATTGAAGAAGGTGC
TTTGCATGGGAGTTGCTGTCGGAAACCTTTCAATGGAGGAGAAGCAGATC
TTCCAGAATGTTCAAATGAGTGTTAACTTCCTTGTCTCATTGTTGAAGAA
AACTGGCAGAATGTCAGGTGCCTCTATCTGAAGAGTACCATGGGTCCTTC
AACCGCATCTTTTAGAAATCTGCTTTATGTGAGTTTGTAGGGAA
back to top