FC931390

Overview
NameFC931390
Unique NameFC931390
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length736
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig3958 contig Ccv1_Contig3958:252..986. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931390 vs. ExPASy Swiss-Prot
Match: BCKD_RAT ([3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Rattus norvegicus GN=Bckdk PE=1 SV=2)

HSP 1 Score: 115.161 bits (287), Expect = 3.840e-25
Identity = 66/214 (30.84%), Postives = 116/214 (54.21%), Query Frame = 1
Query:   61 KKLSETFSKTLIEEVGRWGCMKQTGVSLRYMMEFGSKPTDKNLLISAQFLHKELPIRIARRAIELETLPYGLSEKPAVLKVRDWYLDSFRDLRSFPDIRSTSDERDFTQMIKAIKVRHNNVVPMMALGLQQLKKEMDPKIVYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELHNPNPPPHCIGYIDTKMSPVQVARNASEHARCVCLREYGSAP 702
            K ++  ++++ I+ V     ++ T   + Y    G      +LL S ++L +ELP+RIA R     +LP+ +   P +L V + Y+ +F+ L  FP I+  +DE  + Q+++ +   H +VV ++A GL++ +K +      ED   +  FLD+   SR+GIRML   H+ LH     P  +G I T++SP ++     + AR +C  +YG+AP
Sbjct:   48 KTVTSFYNQSAIDVVAEKPSVRLTPTMMLYS---GRSQDGSHLLKSGRYLQQELPVRIAHRIKGFRSLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLDDHKDVVTLLAEGLRESRKHI------EDEKLVRYFLDKTLTSRLGIRMLATHHLALHEDK--PDFVGIICTRLSPKKIIEKWVDFARRLCEHKYGNAP 250          
BLAST of FC931390 vs. ExPASy Swiss-Prot
Match: BCKD_HUMAN ([3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Homo sapiens GN=BCKDK PE=1 SV=2)

HSP 1 Score: 114.775 bits (286), Expect = 5.015e-25
Identity = 63/184 (34.24%), Postives = 103/184 (55.98%), Query Frame = 1
Query:  151 MMEFGSKPTDKNLLISAQFLHKELPIRIARRAIELETLPYGLSEKPAVLKVRDWYLDSFRDLRSFPDIRSTSDERDFTQMIKAIKVRHNNVVPMMALGLQQLKKEMDPKIVYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELHNPNPPPHCIGYIDTKMSPVQVARNASEHARCVCLREYGSAP 702
            M+  G      +LL SA++L +ELP+RIA R      LP+ +   P +L V + Y+ +F+ L  FP I+  +DE  + Q+++ +   H +VV ++A GL++ +K +      ED   +  FLD+   SR+GIRML   H+ LH     P  +G I T++SP ++     + AR +C  +YG+AP
Sbjct:   75 MLYAGRSQDGSHLLKSARYLQQELPVRIAHRIKGFRCLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLDDHKDVVTLLAEGLRESRKHI------EDEKLVRYFLDKTLTSRLGIRMLATHHLALHEDK--PDFVGIICTRLSPKKIIEKWVDFARRLCEHKYGNAP 250          
BLAST of FC931390 vs. ExPASy Swiss-Prot
Match: BCKD_BOVIN ([3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Bos taurus GN=BCKDK PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 8.554e-25
Identity = 63/184 (34.24%), Postives = 104/184 (56.52%), Query Frame = 1
Query:  151 MMEFGSKPTDKNLLISAQFLHKELPIRIARRAIELETLPYGLSEKPAVLKVRDWYLDSFRDLRSFPDIRSTSDERDFTQMIKAIKVRHNNVVPMMALGLQQLKKEMDPKIVYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELHNPNPPPHCIGYIDTKMSPVQVARNASEHARCVCLREYGSAP 702
            M+  G      +LL SA++L +ELP+RIA R     +LP+ +   P +L V + Y+ +F+ L  FP I+  +DE  + Q+++ +   H +VV ++A GL++ +K +      ED   +  FLD+   SR+GIRML   H+ LH     P  +G I T++SP ++     + AR +C  +YG+AP
Sbjct:   75 MLYSGRSQDGSHLLKSARYLQQELPVRIAHRIKGFRSLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEARYCQLVRQLLDDHKDVVTLLAEGLRESRKYI------EDEKLVRYFLDKTLTSRLGIRMLATHHLALHEDK--PDFVGIICTRLSPKKIIEKWVDFARRLCEHKYGNAP 250          
BLAST of FC931390 vs. ExPASy Swiss-Prot
Match: BCKD_MOUSE ([3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Mus musculus GN=Bckdk PE=1 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.906e-24
Identity = 61/184 (33.15%), Postives = 103/184 (55.98%), Query Frame = 1
Query:  151 MMEFGSKPTDKNLLISAQFLHKELPIRIARRAIELETLPYGLSEKPAVLKVRDWYLDSFRDLRSFPDIRSTSDERDFTQMIKAIKVRHNNVVPMMALGLQQLKKEMDPKIVYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELHNPNPPPHCIGYIDTKMSPVQVARNASEHARCVCLREYGSAP 702
            M+  G      +LL S ++L +ELP+RIA R     +LP+ +   P +L V + Y+ +F+ L  FP I+  +DE  + Q+++ +   H +VV ++A GL++ +K +      +D   +  FLD+   SR+GIRML   H+ LH     P  +G I T++SP ++     + AR +C  +YG+AP
Sbjct:   75 MLYSGRSQDGSHLLKSGRYLQQELPVRIAHRIKGFRSLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLDDHKDVVTLLAEGLRESRKHI------QDEKLVRYFLDKTLTSRLGIRMLATHHLALHEDK--PDFVGIICTRLSPKKIIEKWVDFARRLCEHKYGNAP 250          
BLAST of FC931390 vs. ExPASy Swiss-Prot
Match: PDK_DROME ([Pyruvate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Drosophila melanogaster GN=Pdk PE=2 SV=2)

HSP 1 Score: 109.383 bits (272), Expect = 2.107e-23
Identity = 70/192 (36.46%), Postives = 101/192 (52.60%), Query Frame = 1
Query:  136 VSLRYMMEFGSKPTDKNLLISAQFLHKELPIRIARRAIELETLPYGLSEKPAVLKVRDWYLDSFRDLRSFPDIRSTSDE-RDFTQMIKAIKVRHNNVVPMMALGLQQLKKEMDPKIVYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELH--NPNPPPHCIGYIDTKMSPVQVARNASEHARCVCLREYGSAP 702
            +S++  M+FG    +K   I   FL KELP+R+A    E+  LP  L    +V +V  WY+ SF D+  +     T D  + F   +  I+ RHN+VV  MA G+ ++K+    ++       I  FLDR YMSRI IRMLI QH  L   NP+     IG +D       V R+A E+AR +C + Y ++P
Sbjct:   33 LSIKQFMDFGQNACEKKSYI---FLRKELPVRLANIMKEIALLPDNLLHTRSVSEVSSWYVKSFEDVLVYEKAEPTHDNLQKFVADLDLIRNRHNDVVQTMAQGVIEMKENEGGQVDAPTESSIQYFLDRLYMSRISIRMLINQHTLLFGGNPHAGGRHIGCLDPACDLSDVVRDAYENARFLCDQYYLTSP 221          
BLAST of FC931390 vs. ExPASy Swiss-Prot
Match: PDK3_MOUSE ([Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3, mitochondrial OS=Mus musculus GN=Pdk3 PE=2 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 2.107e-23
Identity = 75/212 (35.38%), Postives = 114/212 (53.77%), Query Frame = 1
Query:   97 EEVGRWGCMKQTGVSLRYMMEFGSKPTDKNLLISAQFLHKELPIRIARRAIELETLPYGLSEKPAVLKVRDWYLDSFRDLRSFPDIRSTSDER---DFTQMIKAIKVRHNNVVPMMALGLQQLKKE--MDPKIVYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELH----NPNPPPHCIGYIDTKMSPVQVARNASEHARCVCLREYGSAPD 705
            +++ R+     + +S++  ++FG     +    S  FL KELP+R+A    E+  LP  L  +P+V  V+ WY+ SF +L  + + +S  D R   +F  ++  I+ RHN+VVP MA G+ + K++   DP I       I  FLDRFY +RI  RMLI QH  L     NP  P H IG ID   +   V ++A E A+ +C + Y  AP+
Sbjct:   14 KQIERYSRFSPSPLSIKQFLDFGRDNACEKT--SYMFLRKELPVRLANTMREVNLLPDNLLNRPSVGLVQSWYMQSFLELLEYEN-KSPEDPRVLDNFLNVLINIRNRHNDVVPTMAQGVIEYKEKFGFDPFI----SSNIQYFLDRFYTNRISFRMLINQHTLLFGGDTNPAHPKH-IGSIDPTCNVADVVKDAYETAKMLCEQYYLVAPE 217          
BLAST of FC931390 vs. ExPASy Swiss-Prot
Match: PDK2_RAT ([Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2, mitochondrial OS=Rattus norvegicus GN=Pdk2 PE=1 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 2.107e-23
Identity = 73/197 (37.06%), Postives = 104/197 (52.79%), Query Frame = 1
Query:  136 VSLRYMMEFGSKPTDKNLLISAQFLHKELPIRIARRAIELETLPYGLSEKPAVLKVRDWYLDSFRDLRSFPDIRSTSDER---DFTQMIKAIKVRHNNVVPMMALGLQQLKKEMDPKIVYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELH----NPNPPPHCIGYIDTKMSPVQVARNASEHARCVCLREYGSAPD 705
            +S++  ++FGS    +    S  FL +ELP+R+A    E+  LP  +   P+V  V+ WY+ S  D+  F D +   D R    FT  +  I+ RHN+VVP MA G+ + K       V      I  FLDRFY+SRI IRMLI QH  +     NP  P H IG ID   S   V ++A + A+ +C + Y ++PD
Sbjct:   31 LSMKQFLDFGSSNACEKT--SFTFLRQELPVRLANIMKEINLLPDRVLSTPSVQLVQSWYVQSLLDIMEFLD-KDPEDHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDTYGDDPVSN--QNIQYFLDRFYLSRISIRMLINQHTLIFDGSTNPAHPKH-IGSIDPNCSVSDVVKDAYDMAKLLCDKYYMASPD 221          
BLAST of FC931390 vs. ExPASy Swiss-Prot
Match: PDK3_HUMAN ([Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3, mitochondrial OS=Homo sapiens GN=PDK3 PE=1 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 2.752e-23
Identity = 74/212 (34.91%), Postives = 115/212 (54.25%), Query Frame = 1
Query:   97 EEVGRWGCMKQTGVSLRYMMEFGSKPTDKNLLISAQFLHKELPIRIARRAIELETLPYGLSEKPAVLKVRDWYLDSFRDLRSFPDIRSTSDER---DFTQMIKAIKVRHNNVVPMMALGLQQLKKE--MDPKIVYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELH----NPNPPPHCIGYIDTKMSPVQVARNASEHARCVCLREYGSAPD 705
            +++ R+     + +S++  ++FG     +    S  FL KELP+R+A    E+  LP  L  +P+V  V+ WY+ SF +L  + + +S  D +   +F Q++  ++ RHN+VVP MA G+ + K++   DP I       I  FLDRFY +RI  RMLI QH  L     NP  P H IG ID   +   V ++A E A+ +C + Y  AP+
Sbjct:   14 KQIERYSRFSPSPLSIKQFLDFGRDNACEKT--SYMFLRKELPVRLANTMREVNLLPDNLLNRPSVGLVQSWYMQSFLELLEYEN-KSPEDPQVLDNFLQVLIKVRNRHNDVVPTMAQGVIEYKEKFGFDPFI----STNIQYFLDRFYTNRISFRMLINQHTLLFGGDTNPVHPKH-IGSIDPTCNVADVVKDAYETAKMLCEQYYLVAPE 217          
BLAST of FC931390 vs. ExPASy Swiss-Prot
Match: PDK2_HUMAN ([Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2, mitochondrial OS=Homo sapiens GN=PDK2 PE=1 SV=2)

HSP 1 Score: 108.997 bits (271), Expect = 2.752e-23
Identity = 72/197 (36.55%), Postives = 105/197 (53.30%), Query Frame = 1
Query:  136 VSLRYMMEFGSKPTDKNLLISAQFLHKELPIRIARRAIELETLPYGLSEKPAVLKVRDWYLDSFRDLRSFPDIRSTSDER---DFTQMIKAIKVRHNNVVPMMALGLQQLKKEMDPKIVYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELH----NPNPPPHCIGYIDTKMSPVQVARNASEHARCVCLREYGSAPD 705
            +S++  ++FGS    +    S  FL +ELP+R+A    E+  LP  +   P+V  V+ WY+ S  D+  F D +   D R    FT  +  I+ RHN+VVP MA G+ + K       V      I  FLDRFY+SRI IRMLI QH  +     NP  P H IG ID   +  +V ++A + A+ +C + Y ++PD
Sbjct:   31 LSMKQFLDFGSSNACEKT--SFTFLRQELPVRLANIMKEINLLPDRVLSTPSVQLVQSWYVQSLLDIMEFLD-KDPEDHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDTYGDDPVSN--QNIQYFLDRFYLSRISIRMLINQHTLIFDGSTNPAHPKH-IGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPD 221          
BLAST of FC931390 vs. ExPASy Swiss-Prot
Match: PDK2_MOUSE ([Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2, mitochondrial OS=Mus musculus GN=Pdk2 PE=1 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 3.594e-23
Identity = 73/197 (37.06%), Postives = 104/197 (52.79%), Query Frame = 1
Query:  136 VSLRYMMEFGSKPTDKNLLISAQFLHKELPIRIARRAIELETLPYGLSEKPAVLKVRDWYLDSFRDLRSFPDIRSTSDER---DFTQMIKAIKVRHNNVVPMMALGLQQLKKEMDPKIVYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELH----NPNPPPHCIGYIDTKMSPVQVARNASEHARCVCLREYGSAPD 705
            +S++  ++FGS    +    S  FL +ELP+R+A    E+  LP  +   P+V  V+ WY+ S  D+  F D +   D R    FT  +  I+ RHN+VVP MA G+ + K       V      I  FLDRFY+SRI IRMLI QH  +     NP  P H IG ID   S   V ++A + A+ +C + Y ++PD
Sbjct:   31 LSMKQFLDFGSSNACEKT--SFTFLRQELPVRLANIMKEINLLPDRVLGTPSVQLVQSWYVQSLLDIMEFLD-KDPEDHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDTYGDDPVSN--QNIQYFLDRFYLSRISIRMLINQHTLIFDGSTNPAHPKH-IGSIDPNCSVSDVVKDAYDMAKLLCDKYYMASPD 221          
The following BLAST results are available for this feature:
BLAST of FC931390 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 21
Match NameE-valueIdentityDescription
BCKD_RAT3.840e-2530.84[3-methyl-2-oxobutanoate dehydrogenase [lipoamide]... [more]
BCKD_HUMAN5.015e-2534.24[3-methyl-2-oxobutanoate dehydrogenase [lipoamide]... [more]
BCKD_BOVIN8.554e-2534.24[3-methyl-2-oxobutanoate dehydrogenase [lipoamide]... [more]
BCKD_MOUSE1.906e-2433.15[3-methyl-2-oxobutanoate dehydrogenase [lipoamide]... [more]
PDK_DROME2.107e-2336.46[Pyruvate dehydrogenase [lipoamide]] kinase, mitoc... [more]
PDK3_MOUSE2.107e-2335.38[Pyruvate dehydrogenase [lipoamide]] kinase isozym... [more]
PDK2_RAT2.107e-2337.06[Pyruvate dehydrogenase [lipoamide]] kinase isozym... [more]
PDK3_HUMAN2.752e-2334.91[Pyruvate dehydrogenase [lipoamide]] kinase isozym... [more]
PDK2_HUMAN2.752e-2336.55[Pyruvate dehydrogenase [lipoamide]] kinase isozym... [more]
PDK2_MOUSE3.594e-2337.06[Pyruvate dehydrogenase [lipoamide]] kinase isozym... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34104F03EF PostHarvP1 Citrus clementina cDNA clone C34104F03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931390 ID=FC931390|Name=FC931390|organism=Citrus clementina|type=EST|length=736bp
GAAAATAGGAATTGGATTTTTTGTGAGAAAGCAGAAGCCAGAAGCAGCAA
TGGCTGACGTAAGAAATTGTCGGAGACGTTTTCGAAGACCTTGATCGAGG
AGGTTGGGCGATGGGGATGCATGAAACAGACAGGTGTGAGCTTGAGGTAC
ATGATGGAGTTTGGCTCAAAACCTACAGACAAAAATTTGCTAATTTCTGC
TCAGTTTCTTCACAAAGAGCTTCCAATTAGAATCGCCAGACGAGCAATTG
AGCTCGAGACACTTCCTTACGGTTTATCCGAGAAGCCTGCCGTTTTGAAG
GTTCGAGACTGGTATTTGGACTCATTTCGTGATTTGAGGTCGTTTCCTGA
CATCAGAAGTACGAGTGATGAGAGGGATTTTACGCAAATGATTAAGGCGA
TTAAGGTGAGGCATAATAATGTGGTGCCCATGATGGCGTTGGGGCTGCAA
CAATTGAAGAAAGAGATGGATCCCAAGATTGTTTACGAGGATCTTGATGA
GATTCATCAGTTTCTGGATCGGTTTTACATGTCTAGGATCGGAATTCGTA
TGCTTATTGGGCAGCATGTAGAATTGCACAATCCCAACCCTCCACCTCAT
TGTATTGGCTACATAGACACAAAAATGTCTCCAGTGCAGGTTGCTAGGAA
TGCTAGTGAGCATGCACGTTGTGTTTGTCTGCGGGAGTATGGCAGTGCAC
CCGATTTTATATCTACGGTGATCCAGTTTTACATTC
back to top