FC931402

Overview
NameFC931402
Unique NameFC931402
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length720
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig5289 contig Ccv1_Contig5289:31..750. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931402 vs. ExPASy Swiss-Prot
Match: YAJO_ECOLI (Uncharacterized oxidoreductase yajO OS=Escherichia coli (strain K12) GN=yajO PE=3 SV=2)

HSP 1 Score: 103.219 bits (256), Expect = 1.441e-21
Identity = 75/221 (33.94%), Postives = 112/221 (50.68%), Query Frame = 2
Query:   80 LELRPLGNTGLRLS-----CVGFGASPLGNVFGAVSENDAVASVREAFRLGINFFDTSPYYGGTLSEKMLGKALKAAGVPRNEYIVSTKCGRYVDGF--DFSAERVTRSIDESLARLQLDYVDILQCHDIEFGSLDQIVNETIPALQKQKEAGKIRFIGITGLPLEIFTYMLD-RVPPGAVDVILSYCHYS-INDSTLEDLLPYLKSKGVGVISASPLCMG 715
            ++  PLG T LR+S     C+ FG    GN    + E  +   ++ A   GINFFDT+  Y    SE+++G+AL+     R + +V+TK    V       S  ++ RSID+SL RL +DYVDILQ H  ++ +    + ET+ AL    +AGK R+IG + +    F   L+ +   G    +    HY+ I      ++LP    +GV VI  SPL  G
Sbjct:    1 MQYNPLGKTDLRVSRLCLGCMTFGEPDRGNHAWTLPEESSRPIIKRALEGGINFFDTANSYSDGSSEEIVGRALRDF-ARREDVVVATKVFHRVGDLPEGLSRAQILRSIDDSLRRLGMDYVDILQIHRWDYNT---PIEETLEALNDVVKAGKARYIGASSMHASQFAQALELQKQHGWAQFVSMQDHYNLIYREEEREMLPLCYQEGVAVIPWSPLARG 217          
BLAST of FC931402 vs. ExPASy Swiss-Prot
Match: YQKF_BACSU (Uncharacterized oxidoreductase yqkF OS=Bacillus subtilis GN=yqkF PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.761e-19
Identity = 64/216 (29.63%), Postives = 116/216 (53.70%), Query Frame = 2
Query:   89 RPLGNTGLRLSCVGFGASPLGNVFGAVSENDAVASVREAFRLGINFFDTSPYYGGTLSEKMLGKALKAAGVPRNEYIVSTKCG-RYVDG-----FDFSAERVTRSIDESLARLQLDYVDILQCHDIEFGSLDQIVNETIPALQKQKEAGKIRFIGITGLPLEIFTYMLDRVPPGAVDVILSYCHYSINDSTLEDLLPYLKSKGVGVISASPLCMGL 718
            R LG + L +S VG G   LG       +N A++ + EA  LGIN+ DT+  Y    +E+++G A++     R++ I++TK G R+ DG     +D S   +  ++ +SL RL+ DY+D+ Q H    G+++  ++ETI A ++ K+ G IR+ GI+ +   +    + +      +++     +S+ D   E+ LP L+   + V++  P+  GL
Sbjct:    4 RKLGTSDLDISEVGLGCMSLGT-----EKNKALSILDEAIELGINYLDTADLYDRGRNEEIVGDAIQNR---RHDIILATKAGNRWDDGSEGWYWDPSKAYIKEAVKKSLTRLKTDYIDLYQLHG---GTIEDNIDETIEAFEELKQEGVIRYYGISSIRPNVIKEYVKK-----SNIVSIMMQFSLFDRRPEEWLPLLEEHQISVVARGPVAKGL 203          
BLAST of FC931402 vs. ExPASy Swiss-Prot
Match: YCCK_BACSU (Uncharacterized oxidoreductase yccK OS=Bacillus subtilis GN=yccK PE=3 SV=2)

HSP 1 Score: 96.2857 bits (238), Expect = 1.761e-19
Identity = 73/219 (33.33%), Postives = 116/219 (52.97%), Query Frame = 2
Query:   83 ELRPLGNTGLRLSCVGFGASPLG--NVFGAVSENDAVASVREAFRLGINFFDTSPYYGGTLSEKMLGKALKAAGVPRNEYIVSTK-CGRYVDG---FDFSAERVTRSIDESLARLQLDYVDILQCHDIEFGSLDQIVNETIPALQKQKEAGKIRFIGITGLPLEIFTYMLDRVPPGAVDVILSYCHYSINDSTLE-DLLPYLKSKGVGVISASPLCMGL 718
            + R LG T L++  +GFGA+ +G  N+F  +++      VR A   G+NF DT+  YG   SE+++G+ ++  GV RNE I++TK   + VDG    D S E +   +++SL RL+ DY+D+   H   F      + E    L++ K+ GKI+ IG + L    +  + D    G ++V      YS+     E +LLPY + +G+  I   PL  GL
Sbjct:    3 QTRTLGKTKLKVKRIGFGANAVGGHNLFPNLNDETGKDLVRTALDGGVNFIDTAFIYGLGRSEELIGEVVQERGV-RNELIIATKGAHKEVDGSIELDNSREFLRSEVEKSLKRLKTDYIDLYYVH---FPDGKTPLAEVAGTLKELKDEGKIKAIGASNLD---YQQLQDFNADGYLEVF--QAEYSLIQRDAEKELLPYCEKQGISFIPYFPLASGL 212          
BLAST of FC931402 vs. ExPASy Swiss-Prot
Match: IOLS_BACSU (Protein iolS OS=Bacillus subtilis GN=iolS PE=1 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 3.004e-19
Identity = 67/214 (31.31%), Postives = 107/214 (50.00%), Query Frame = 2
Query:   95 LGNTGLRLSCVGFGASPLG--NVFGAVSENDAVASVREAFRLGINFFDTSPYYGGTLSEKMLGKALKAAGVPRNEYIVSTKCGRYVDG----FDFSAERVTRSIDESLARLQLDYVDILQCHDIEFGSLDQIVNETIPALQKQKEAGKIRFIGITGLPLEIFTYMLDRVPPGAVDVILSYCHYSINDSTLEDLLPYLKSKGVGVISASPLCMGL 718
            LG + L++  +G G + +G  N++  ++E      VREA R G+   DT+  YG   SE+++G+ L+     R + +++TK      G    FD S + + +S+DESL RL  DY+D+   H   F       +E + AL + K+AGKIR IG++   LE    + +    G VDV+    +  +N    +   PY K   +  I   PL  GL
Sbjct:    6 LGKSDLQVFPIGLGTNAVGGHNLYPNLNEETGKELVREAIRNGVTMLDTAYIYGIGRSEELIGEVLREFN--REDVVIATKAAHRKQGNDFVFDNSPDFLKKSVDESLKRLNTDYIDLFYIH---FPDEHTPKDEAVNALNEMKKAGKIRSIGVSNFSLE---QLKEANKDGLVDVLQGE-YNLLNREAEKTFFPYTKEHNISFIPYFPLVSGL 210          
BLAST of FC931402 vs. ExPASy Swiss-Prot
Match: ARA2_YEAST (D-arabinose 1-dehydrogenase OS=Saccharomyces cerevisiae GN=ARA2 PE=1 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.947e-18
Identity = 66/187 (35.29%), Postives = 100/187 (53.48%), Query Frame = 2
Query:  194 VREAFRLGINFFDTSPYYGGTLSEKMLGKALKAAG--VPRNEYIVSTKCGRY-VDGFDFSAERVTRSIDESLARLQLDYVDILQCHDIEFGSLDQIVNETIPALQKQKEAGKIRFIGITGLPLEIFTYMLDRVPP-----GAVDVILSYCHYSINDSTL----EDLLPYLKSKGVGVISASPLCMGL 718
            ++ AF  GIN  DTSPYYG   SE + G+AL       PR+ Y + TK GR   + F++S + V  S+  S  RL   Y+D++  HD+EF     I+ E +  L+  K  G I+  GI+G P++  T++ +         G++D +LSYC+ ++ ++ L    E LL   K K   V +AS L M L
Sbjct:   41 IKYAFSHGINAIDTSPYYGP--SEVLYGRALSNLRNEFPRDTYFICTKVGRIGAEEFNYSRDFVRFSVHRSCERLHTTYLDLVYLHDVEFVKFPDIL-EALKELRTLKNKGVIKNFGISGYPIDFITWLAEYCSTEESDIGSLDAVLSYCNLNLQNNKLLNFRERLLRNAKLK--MVCNASILSMSL 222          
BLAST of FC931402 vs. ExPASy Swiss-Prot
Match: YDJG_ECOLI (Uncharacterized oxidoreductase ydjG OS=Escherichia coli (strain K12) GN=ydjG PE=3 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.543e-18
Identity = 74/227 (32.60%), Postives = 108/227 (47.58%), Query Frame = 2
Query:   92 PLGNTGLRLSCVGFGASPLGNV---FGAVSENDAVASVREAFRLGINFFDTSPYYGGTLSEKMLGKALKAAGVPRNEYIVSTKCG----RYVDGF----------DFSAERVTRSIDESLARLQLDYVDILQCHDIEFGSLDQIVNETIPALQKQKEAGKIRFIGITGLPLEIFTYMLDRVPPGAVDVILSYCHYSINDSTLE-DLLPYLKSKGVGVISASPLCMGL 718
            PLG T + LS +G G   +G      G +     + ++ EA R GIN  DT+P Y    SE ++G+ALK   +PR + +V TKCG    R    F          + S E +   +  SL RL +DY+DI   H          + ET+  L + K  GKIR IG   +  +   ++ + +  G +D+I     YSI D  +E +LLP  +  G+ V   SPL  GL
Sbjct:    5 PLGTTDITLSRMGLGTWAIGGGPAWNGDLDRQICIDTILEAHRCGINLIDTAPGYNFGNSEVIVGQALKK--LPREQVVVETKCGIVWERKGSLFNKVGDRQLYKNLSPESIREEVAASLQRLGIDYIDIYMTHWQSVPPFFTPIAETVAVLNELKSEGKIRAIGAANVDAD---HIREYLQYGELDII--QAKYSILDRAMENELLPLCRDNGIVVQVYSPLEQGL 224          
BLAST of FC931402 vs. ExPASy Swiss-Prot
Match: GS69_BACSU (General stress protein 69 OS=Bacillus subtilis GN=yhdN PE=1 SV=2)

HSP 1 Score: 87.0409 bits (214), Expect = 1.069e-16
Identity = 61/219 (27.85%), Postives = 106/219 (48.40%), Query Frame = 2
Query:   80 LELRPLGNTGLRLSCVGFGASPLGN-VFGAVSENDAVASVREAFRLGINFFDTSPYYGGTLSEKMLGKALKAAGVPRNEYIVSTKCGRYVDGFDF----SAERVTRSIDESLARLQLDYVDILQCHDIEFGSLDQIVNETIPALQKQKEAGKIRFIGITGLPLEIFTYMLDRVPPGAVDVILSYCHYSINDSTLED-LLPYLKSKGVGVISASPLCMGL 718
            +E   + +TG+  S +G G   +G  ++G   E  ++ ++R A   GI   DT+P YG   SE+++GKA+K  G  R++ I++TK              +  R+   ++ SL RLQ DY+D+ Q H   +      + ET   +++  +AGKIR IG++   +E         P   +        Y++ +  +E+ +LPY K   +  +    LC GL
Sbjct:    1 MEYTSIADTGIEASRIGLGTWAIGGTMWGGTDEKTSIETIRAALDQGITLIDTAPAYGFGQSEEIVGKAIKEYG-KRDQVILATKTALDWKNNQLFRHANRARIVEEVENSLKRLQTDYIDLYQVH---WPDPLVPIEETAEVMKELYDAGKIRAIGVSNFSIEQMDTFRAVAPLHTIQP-----PYNLFEREMEESVLPYAKDNKITTLLYGSLCRGL 210          
BLAST of FC931402 vs. ExPASy Swiss-Prot
Match: PLD_MICLT (Pyridoxal 4-dehydrogenase OS=Microbacterium luteolum GN=pld1 PE=1 SV=3)

HSP 1 Score: 81.6481 bits (200), Expect = 4.489e-15
Identity = 70/255 (27.45%), Postives = 109/255 (42.75%), Query Frame = 2
Query:   71 LRKLELRPLGNTGLRLSCVGFGASPLGNVFGAVSENDAVASVREAFRLGINFFDTSPYYGGTLSEKMLGKALKAAGVPRNEYIVSTKCGR-----------------------------YVDGFDFSAERVTRSIDESLARLQLDYVDILQCHDI---------EFGSLDQIVNETIPALQKQKEAGKIRFIGITGLPLEIFTYMLDRVPPGAVDVILSYCHYSINDSTLE-DLLPYLKSKGVGVISASPLCMGL 718
            L+  E R LG TGL ++ +G G +PLG ++  VS  DA A +   +  GI +FD++P YG    E +LG  L+         ++STK GR                             + + FD+S + V RS D+S  RL    +D+L  HDI         EF            AL + + AG I+     GL +  +  + D +    +D  L    YS+ D   E + LP  + +G+ ++ A     G+
Sbjct:    3 LKASEKRALGRTGLTVTALGLGTAPLGGLYAPVSRADADALLEAGWDSGIRYFDSAPMYGYGRCEHLLGDMLRE---KPERAVISTKVGRLMTNERAGRTLPPAPPKNPLDSGWHNGLNFREVFDYSYDGVMRSFDDSQQRLGFPEIDLLYVHDIGRVTHADRHEFHWNALTRGGGFRALTELRAAGNIKGF---GLGVNEWQIIRDALEEADLDCSLLAGRYSLLDQVSEKEFLPLAQKRGMALVIAGVFNSGI 251          
BLAST of FC931402 vs. ExPASy Swiss-Prot
Match: YGHZ_ECOLI (Uncharacterized protein yghZ OS=Escherichia coli (strain K12) GN=yghZ PE=1 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.306e-14
Identity = 69/235 (29.36%), Postives = 123/235 (52.34%), Query Frame = 2
Query:   50 LIQMAFPLR--KLELRPLGNTGLRLSCVGFGASPLGNVFGAVSENDAVASV-REAFRLGINFFDTSPYYGGT--LSEKMLGKALKAA-GVPRNEYIVSTKCGRYV----DGFDFSAERVTRSIDESLARLQLDYVDILQCHDIEFGSLDQIVNETIPALQKQKEAGKIRFIGITGLPLEIFTYMLDRVPPGAVDVILSYCHYSINDSTLE--DLLPYLKSKGVGVISASPLCMGL 718
            ++ +A P R  +++ R  G +GLRL  +  G   L + FG V+  ++  ++ R+AF LGI  FD +  YG     +E+  G+ L+      R+E I+STK G  +     G   S + +  S+D+SL R+ L+YVDI   H ++  +    + ET  AL    ++GK  ++GI+    E    M++ +    + +++    Y++ +  ++   LL  L++ GVG I+ +PL  GL
Sbjct:    1 MVWLANPERYGQMQYRYCGKSGLRLPALSLG---LWHNFGHVNALESQRAILRKAFDLGITHFDLANNYGPPPGSAEENFGRLLREDFAAYRDELIISTKAGYDMWPGPYGSGGSRKYLLASLDQSLKRMGLEYVDIFYSHRVDENT---PMEETASALAHAVQSGKALYVGISSYSPERTQKMVELLREWKIPLLIHQPSYNLLNRWVDKSGLLDTLQNNGVGCIAFTPLAQGL 229          
BLAST of FC931402 vs. ExPASy Swiss-Prot
Match: YGHZ_ECO57 (Uncharacterized protein yghZ OS=Escherichia coli O157:H7 GN=yghZ PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.306e-14
Identity = 69/235 (29.36%), Postives = 123/235 (52.34%), Query Frame = 2
Query:   50 LIQMAFPLR--KLELRPLGNTGLRLSCVGFGASPLGNVFGAVSENDAVASV-REAFRLGINFFDTSPYYGGT--LSEKMLGKALKAA-GVPRNEYIVSTKCGRYV----DGFDFSAERVTRSIDESLARLQLDYVDILQCHDIEFGSLDQIVNETIPALQKQKEAGKIRFIGITGLPLEIFTYMLDRVPPGAVDVILSYCHYSINDSTLE--DLLPYLKSKGVGVISASPLCMGL 718
            ++ +A P R  +++ R  G +GLRL  +  G   L + FG V+  ++  ++ R+AF LGI  FD +  YG     +E+  G+ L+      R+E I+STK G  +     G   S + +  S+D+SL R+ L+YVDI   H ++  +    + ET  AL    ++GK  ++GI+    E    M++ +    + +++    Y++ +  ++   LL  L++ GVG I+ +PL  GL
Sbjct:    1 MVWLANPERYGQMQYRYCGKSGLRLPALSLG---LWHNFGHVNALESQRAILRKAFDLGITHFDLANNYGPPPGSAEENFGRLLREDFAAYRDELIISTKAGYDMWPGPYGSGGSRKYLLASLDQSLKRMGLEYVDIFYSHRVDENT---PMEETASALAHAVQSGKALYVGISSYSPERTQKMVELLHEWKIPLLIHQPSYNLLNRWVDKSGLLDTLQNNGVGCIAFTPLAQGL 229          
The following BLAST results are available for this feature:
BLAST of FC931402 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 30
Match NameE-valueIdentityDescription
YAJO_ECOLI1.441e-2133.94Uncharacterized oxidoreductase yajO OS=Escherichia... [more]
YQKF_BACSU1.761e-1929.63Uncharacterized oxidoreductase yqkF OS=Bacillus su... [more]
YCCK_BACSU1.761e-1933.33Uncharacterized oxidoreductase yccK OS=Bacillus su... [more]
IOLS_BACSU3.004e-1931.31Protein iolS OS=Bacillus subtilis GN=iolS PE=1 SV=... [more]
ARA2_YEAST1.947e-1835.29D-arabinose 1-dehydrogenase OS=Saccharomyces cerev... [more]
YDJG_ECOLI2.543e-1832.60Uncharacterized oxidoreductase ydjG OS=Escherichia... [more]
GS69_BACSU1.069e-1627.85General stress protein 69 OS=Bacillus subtilis GN=... [more]
PLD_MICLT4.489e-1527.45Pyridoxal 4-dehydrogenase OS=Microbacterium luteol... [more]
YGHZ_ECOLI1.306e-1429.36Uncharacterized protein yghZ OS=Escherichia coli (... [more]
YGHZ_ECO571.306e-1429.36Uncharacterized protein yghZ OS=Escherichia coli O... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34104G03EF PostHarvP1 Citrus clementina cDNA clone C34104G03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931402 ID=FC931402|Name=FC931402|organism=Citrus clementina|type=EST|length=720bp
GCTCACAAAATTTTTCCCACTTCCCAAACGCCTCTCAGAAGCCCTAAACT
TAATTCAAATGGCATTCCCACTTCGCAAATTAGAGCTCCGACCATTGGGC
AACACGGGCCTCCGCCTCAGTTGCGTCGGCTTCGGCGCCTCGCCGCTCGG
CAACGTTTTTGGGGCCGTCTCTGAAAACGACGCCGTTGCCTCCGTCCGCG
AAGCATTTCGCCTTGGCATCAACTTCTTTGACACTTCTCCATATTATGGA
GGGACATTGTCTGAGAAGATGCTTGGTAAGGCACTGAAAGCTGCGGGCGT
TCCGAGAAATGAGTATATTGTGTCAACAAAATGCGGGCGGTATGTTGACG
GTTTTGATTTTAGTGCTGAGAGAGTGACTAGGAGCATTGATGAGAGCTTG
GCGAGGTTGCAGCTTGATTACGTCGATATACTGCAGTGCCATGACATTGA
ATTTGGGTCTCTTGACCAGATTGTGAATGAGACCATTCCTGCCCTTCAGA
AGCAGAAGGAAGCAGGGAAAATCCGTTTCATTGGTATTACCGGACTTCCC
TTGGAAATTTTTACCTACATGCTTGATCGGGTGCCACCTGGTGCAGTTGA
TGTAATTCTTTCGTACTGCCATTACAGTATTAATGATTCAACATTGGAGG
ATTTACTGCCTTACTTGAAGAGCAAGGGTGTAGGCGTCATTAGTGCTTCC
CCTCTTTGCATGGGGCTTCT
back to top