FC931404

Overview
NameFC931404
Unique NameFC931404
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length261
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931404 vs. ExPASy Swiss-Prot
Match: TCTP_HEVBR (Translationally-controlled tumor protein homolog OS=Hevea brasiliensis GN=TCTP PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 2.688e-32
Identity = 68/85 (80.00%), Postives = 72/85 (84.71%), Query Frame = 2
Query:    5 DSFMLHELPAFDKNALVTYMKRFIKLLTPILSEERPEISEKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTF 259
            D+F L E PAFDK   VTYMKRFIKLLTP L EE+ E  +KNIEGATKFLLSKLSDLQFFVGESMHDDG LVFAYY+ GATDPTF
Sbjct:   72 DTFRLQEQPAFDKKQFVTYMKRFIKLLTPKLDEEKQESFKKNIEGATKFLLSKLSDLQFFVGESMHDDGSLVFAYYRGGATDPTF 156          
BLAST of FC931404 vs. ExPASy Swiss-Prot
Match: TCTP_ELAGV (Translationally-controlled tumor protein homolog OS=Elaeis guineensis var. tenera GN=TCTP PE=2 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 7.820e-32
Identity = 65/85 (76.47%), Postives = 73/85 (85.88%), Query Frame = 2
Query:    5 DSFMLHELPAFDKNALVTYMKRFIKLLTPILSEERPEISEKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTF 259
            D+F L E PAFDK   VT+MKR+IK LTP L  E+ E+ +K+IEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYK+GATDPTF
Sbjct:   72 DTFRLQEQPAFDKKQFVTFMKRYIKNLTPKLDAEKQELFKKHIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKDGATDPTF 156          
BLAST of FC931404 vs. ExPASy Swiss-Prot
Match: TCTP_SOYBN (Translationally-controlled tumor protein homolog OS=Glycine max GN=TCTP PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 4.016e-28
Identity = 59/85 (69.41%), Postives = 68/85 (80.00%), Query Frame = 2
Query:    5 DSFMLHELPAFDKNALVTYMKRFIKLLTPILSEERPEISEKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTF 259
            D+F L E PAFDK   VT+MKRFIK LTP L  E+ E+ +K+IEGATK+LLSK+ D QFFVGESM DD CLVFAYYK+GA DPTF
Sbjct:   72 DTFRLQEQPAFDKKQFVTFMKRFIKNLTPKLDAEQQELFKKHIEGATKYLLSKIKDFQFFVGESMGDDACLVFAYYKDGAADPTF 156          
BLAST of FC931404 vs. ExPASy Swiss-Prot
Match: TCTP_CUCMA (Translationally-controlled tumor protein homolog OS=Cucurbita maxima GN=TCTP PE=2 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 5.245e-28
Identity = 57/85 (67.06%), Postives = 66/85 (77.65%), Query Frame = 2
Query:    5 DSFMLHELPAFDKNALVTYMKRFIKLLTPILSEERPEISEKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTF 259
            D+F L E P  DK   + Y+K+FIKLLTP L  E+ E  +KNIEGATKFLL KL D +FFVGESMHDD C+VFAYY+EGATDPTF
Sbjct:   72 DTFRLQEQPTMDKKQFIAYIKKFIKLLTPKLEGEKQEAFKKNIEGATKFLLPKLKDFRFFVGESMHDDSCIVFAYYREGATDPTF 156          
BLAST of FC931404 vs. ExPASy Swiss-Prot
Match: TCTP_MEDSA (Translationally-controlled tumor protein homolog OS=Medicago sativa GN=TCTP PE=2 SV=2)

HSP 1 Score: 121.324 bits (303), Expect = 1.526e-27
Identity = 58/85 (68.24%), Postives = 68/85 (80.00%), Query Frame = 2
Query:    5 DSFMLHELPAFDKNALVTYMKRFIKLLTPILSEERPEISEKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTF 259
            D F L E PAFDK   + ++KR+IKLLTP L  E+ E+ +K+IEGATK+LL KL DLQFFVGESMHDDG LVFAYYK+GA DPTF
Sbjct:   71 DVFRLQEQPAFDKKQFLGFVKRYIKLLTPKLDAEKQELFKKHIEGATKYLLCKLKDLQFFVGESMHDDGSLVFAYYKDGAADPTF 155          
BLAST of FC931404 vs. ExPASy Swiss-Prot
Match: TCTP_SOLLC (Translationally-controlled tumor protein homolog OS=Solanum lycopersicum GN=TCTP PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 1.993e-27
Identity = 59/85 (69.41%), Postives = 65/85 (76.47%), Query Frame = 2
Query:    5 DSFMLHELPAFDKNALVTYMKRFIKLLTPILSEERPEISEKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTF 259
            D+F L E PAFDK   VT+MKR+IK LTP L  E  E  +KNIE ATKFLL K+ DLQFFVGESMHDDG LVFAYYKEG+ DP F
Sbjct:   72 DTFRLQEQPAFDKKQFVTFMKRYIKNLTPKLEGETQEAFKKNIEAATKFLLQKIKDLQFFVGESMHDDGALVFAYYKEGSADPPF 156          
BLAST of FC931404 vs. ExPASy Swiss-Prot
Match: TCTP_ORYSJ (Translationally-controlled tumor protein homolog OS=Oryza sativa subsp. japonica GN=TCTP PE=1 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 3.400e-27
Identity = 59/85 (69.41%), Postives = 67/85 (78.82%), Query Frame = 2
Query:    5 DSFMLHELPAFDKNALVTYMKRFIKLLTPILSEERPEISEKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTF 259
            D+F L E P FDK   VT+MKR+IK L+  L  E+ E  +KNIEGATK+LL KL DLQFFVGESMHDDG LVFAYYK+GATDPTF
Sbjct:   72 DTFRLQEQPPFDKKQFVTFMKRYIKNLSAKLDAEKQEEFKKNIEGATKYLLGKLKDLQFFVGESMHDDGGLVFAYYKDGATDPTF 156          
BLAST of FC931404 vs. ExPASy Swiss-Prot
Match: TCTP_SOLTU (Translationally-controlled tumor protein homolog OS=Solanum tuberosum GN=TCTP PE=2 SV=2)

HSP 1 Score: 119.013 bits (297), Expect = 7.574e-27
Identity = 58/85 (68.24%), Postives = 64/85 (75.29%), Query Frame = 2
Query:    5 DSFMLHELPAFDKNALVTYMKRFIKLLTPILSEERPEISEKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTF 259
            D+F L E PAFDK   VTY+KR+IK LTP L  E  E  +KNIE ATKFLLSKL D QFFVGE MHDD  LVFAYYK+G+ DPTF
Sbjct:   72 DTFRLQEQPAFDKKQFVTYIKRYIKNLTPKLEGEAQEAFKKNIESATKFLLSKLKDFQFFVGEGMHDDSALVFAYYKDGSADPTF 156          
BLAST of FC931404 vs. ExPASy Swiss-Prot
Match: TCTP_FRAAN (Translationally-controlled tumor protein homolog OS=Fragaria ananassa GN=TCTP PE=2 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 7.574e-27
Identity = 61/85 (71.76%), Postives = 67/85 (78.82%), Query Frame = 2
Query:    5 DSFMLHELPAFDKNALVTYMKRFIKLLTPILSEERPEISEKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTF 259
            D+F L E P FDK   VT++KR+IKLLTP L  E+ E  +KNIEGATKFLLSKLSDLQFFVGESM DD  LVFA YKEGATDP F
Sbjct:   74 DTFRLQEQPPFDKKQFVTWVKRYIKLLTPKLEGEQQETFKKNIEGATKFLLSKLSDLQFFVGESMGDDTSLVFASYKEGATDPIF 158          
BLAST of FC931404 vs. ExPASy Swiss-Prot
Match: TCTP_PEA (Translationally-controlled tumor protein homolog OS=Pisum sativum GN=TCTP PE=2 SV=2)

HSP 1 Score: 118.627 bits (296), Expect = 9.892e-27
Identity = 57/85 (67.06%), Postives = 66/85 (77.65%), Query Frame = 2
Query:    5 DSFMLHELPAFDKNALVTYMKRFIKLLTPILSEERPEISEKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTF 259
            D F L E P FDK   + ++K++IKLLTP L  E+ E  +KNIEGATK+LL KL DLQFFVGESMHDDG LVFAYYK+GA DPTF
Sbjct:   71 DVFRLQEQPPFDKKQFLGFVKKYIKLLTPKLEAEKQEHFKKNIEGATKYLLGKLKDLQFFVGESMHDDGSLVFAYYKDGAADPTF 155          
The following BLAST results are available for this feature:
BLAST of FC931404 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 18
Match NameE-valueIdentityDescription
TCTP_HEVBR2.688e-3280.00Translationally-controlled tumor protein homolog O... [more]
TCTP_ELAGV7.820e-3276.47Translationally-controlled tumor protein homolog O... [more]
TCTP_SOYBN4.016e-2869.41Translationally-controlled tumor protein homolog O... [more]
TCTP_CUCMA5.245e-2867.06Translationally-controlled tumor protein homolog O... [more]
TCTP_MEDSA1.526e-2768.24Translationally-controlled tumor protein homolog O... [more]
TCTP_SOLLC1.993e-2769.41Translationally-controlled tumor protein homolog O... [more]
TCTP_ORYSJ3.400e-2769.41Translationally-controlled tumor protein homolog O... [more]
TCTP_SOLTU7.574e-2768.24Translationally-controlled tumor protein homolog O... [more]
TCTP_FRAAN7.574e-2771.76Translationally-controlled tumor protein homolog O... [more]
TCTP_PEA9.892e-2767.06Translationally-controlled tumor protein homolog O... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34104G05EF PostHarvP1 Citrus clementina cDNA clone C34104G05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931404 ID=FC931404|Name=FC931404|organism=Citrus clementina|type=EST|length=261bp
TGCCGACTCATTCATGCTACACGAGCTACCCGCTTTTGACAAGAATGCGC
TTGTAACATACATGAAGAGATTCATCAAGTTGCTGACGCCCATACTGAGC
GAGGAGAGGCCGGAGATTTCTGAGAAGAATATTGAGGGAGCGACCAAGTT
CTTGCTCTCGAAGCTCAGTGACCTTCAATTCTTTGTTGGGGAGAGCATGC
ATGATGATGGCTGTCTTGTCTTTGCTTACTACAAGGAAGGTGCGACCGAC
CCAACATTTTT
back to top