FC931406

Overview
NameFC931406
Unique NameFC931406
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length157
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14256 contig Ccv1_Contig14256:9..165. BLAST: Citrus Unigene V1 Contigs to TAIR9
Homology
BLAST of FC931406 vs. ExPASy Swiss-Prot
Match: M030_ARATH (Uncharacterized mitochondrial protein AtMg00030 OS=Arabidopsis thaliana GN=AtMg00030 PE=4 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 3.174e-25
Identity = 50/51 (98.04%), Postives = 50/51 (98.04%), Query Frame = -3
Query:    3 KFEKSKERRLATELGYGFPIGDPWITDGISPWPFASESVLPSQCPGIHPMH 155
            KF KSKERRLATELGYGFPIGDPWITDGISPWPFASESVLPSQCPGIHPMH
Sbjct:    6 KFSKSKERRLATELGYGFPIGDPWITDGISPWPFASESVLPSQCPGIHPMH 56          
The following BLAST results are available for this feature:
BLAST of FC931406 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
M030_ARATH3.174e-2598.04Uncharacterized mitochondrial protein AtMg00030 OS... [more]
back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34104G07EF PostHarvP1 Citrus clementina cDNA clone C34104G07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931406 ID=FC931406|Name=FC931406|organism=Citrus clementina|type=EST|length=157bp
GAATGCATTGGATGGATGCCCGGGCATTGAGAAGGAAGGACGCTTTCAGA
GGCGAAAGGCCATGGGGAGATACCGTCTGTGATCCATGGATCTCCGATCG
GGAAACCGTATCCAAGCTCCGTGGCTAGTCTGCGCTCTTTGGACTTTTCA
AACTTAG
back to top