FC931408

Overview
NameFC931408
Unique NameFC931408
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length700
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig11767 contig Ccv1_Contig11767:567..1266. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931408 vs. ExPASy Swiss-Prot
Match: LOXC2_ORYSJ (Probable lipoxygenase 8, chloroplastic OS=Oryza sativa subsp. japonica GN=CM-LOX2 PE=2 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 2.342e-61
Identity = 128/242 (52.89%), Postives = 164/242 (67.77%), Query Frame = 2
Query:    2 EMYLKDIVL---DGLPNGPV-NVTCNSWLHSKHDNKQ----KRVFFTNKLYLPSQTPDGLKRYRAEELTILRGNGQGERKTYDRIYDYDVYNDLGDPDKKPELARPVLGG-KQNPYPRRCRTGRPRCDTDQFSEKREGNFYVPRDEAFSEVKQLTFSAKTVYSVLHALVPSLETAFVDP---DLGFPYFSAIDALFNEGVNLPPLKQEGFWNTLLPRLVKAIEDT-GDNILLFETPETMDRD 688
            EM+L+D+ L   DG  N  V  + CNSW+  K    +    KR+FF  K YLP QTP GL+ YR E+L   RGNG G+R+  DR+YDYDVYNDLG+PD   +LARPVLGG KQ PYPRRCRTGRP    D  SE R+GN YVPRDE FSEVK   F  KT+ SVLHA VP+ ++A +D    +L FP F  ID LF +GV LP +++ GF ++++PRL++ + D+ GD ILLF+TP  + +D
Sbjct:  194 EMFLEDLNLTAGDGAGNSTVLPIRCNSWVQPKSSIDEGTPGKRIFFA-KAYLPGQTPAGLRSYREEDLKQKRGNGAGQREADDRVYDYDVYNDLGNPDSNGDLARPVLGGSKQFPYPRRCRTGRPPSKKDPKSETRKGNVYVPRDEEFSEVKNAQFLLKTLQSVLHAAVPAAQSALIDNLSLNLPFPSFFVIDKLFEDGVELPGVEKLGFLHSIVPRLLELLRDSPGDKILLFDTPANVQKD 434          
BLAST of FC931408 vs. ExPASy Swiss-Prot
Match: LOX2_ARATH (Lipoxygenase 2, chloroplastic OS=Arabidopsis thaliana GN=LOX2 PE=1 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 2.863e-59
Identity = 116/233 (49.79%), Postives = 156/233 (66.95%), Query Frame = 2
Query:    2 EMYLKDIVLDGLPNGPVNVTCNSWLHSKHDNKQKRVFFTNKLYLPSQTPDGLKRYRAEELTILRGNGQ---GERKTYDRIYDYDVYNDLGDPDKKPELARPVLGGKQNPYPRRCRTGRPRCDTDQFSEKR-EGNFYVPRDEAFSEVKQLTFSAKTVYSVLHALVPSLETAFVDPDLGFPYFSAIDALFNEGVNLPPLKQEGFWNTLLPRLVKAIEDTGDNILLFETPETMDRD 688
            +++LK + L  LP G +  TC SW+  K  +  KR+FF++K YLPSQTP+ LK+YR EEL  L+G  +   GE   ++RIYDYDVYND+GDPD  PELARPV+GG  +PYPRRC+TGR  C+TD  SE+R  G FYVPRDE FS  K  +F+ K V + L ++ P +E+  + P   FP+F AI  LF EG+ LP  K  G    LLPR++KA+ +  D+IL F+ P  ++RD
Sbjct:  162 QLFLKGVELK-LPGGSITFTCESWVAPKSVDPTKRIFFSDKSYLPSQTPEPLKKYRKEELETLQGKNREEVGEFTKFERIYDYDVYNDVGDPDNDPELARPVIGGLTHPYPRRCKTGRKPCETDPSSEQRYGGEFYVPRDEEFSTAKGTSFTGKAVLAALPSIFPQIESVLLSPQEPFPHFKAIQNLFEEGIQLP--KDAGLL-PLLPRIIKALGEAQDDILQFDAPVLINRD 390          
BLAST of FC931408 vs. ExPASy Swiss-Prot
Match: LOX4_ARATH (Lipoxygenase 4, chloroplastic OS=Arabidopsis thaliana GN=LOX4 PE=2 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 3.165e-58
Identity = 113/233 (48.50%), Postives = 156/233 (66.95%), Query Frame = 2
Query:    2 EMYLKDIVLDGLPNGPVNVTCNSWLHSKHDNKQKRVFFTNKLYLPSQTPDGLKRYRAEELTILRGNGQGERKTYDRIYDYDVYNDLGDPDKKPELARPVLGGKQNPYPRRCRTGRPRCDTDQFSEKREGN---FYVPRDEAFSEVKQLTFSAKTVYSVLHALVPSLETAFVDPDLGFPYFSAIDALFNEGVNLP-PLKQEGFWNTLLPRLVKAIEDTGDNILLFETPETMDRD 688
            E +L+ I ++G   GPV+  CNSW+ S+ D+  KR+ FTN+ YLPS+TP GL+  R +EL  LRGNG+GERK  DRIYDYDVYND+G+PD   ELARP LGG++ PYPRRCRTGR   DTD  SE+R       YVPRDE F E KQ TF+A  + +VLH L+PSL+ + +  D  F  F  ID+L+ EG+ L    + + F    LP++V  ++ + + +L ++TP+ + +D
Sbjct:  190 EFFLESITIEGFACGPVHFPCNSWVQSQKDHPSKRILFTNQPYLPSETPSGLRTLREKELENLRGNGKGERKLSDRIYDYDVYNDIGNPDISRELARPTLGGREFPYPRRCRTGRSSTDTDMMSERRVEKPLPMYVPRDEQFEESKQNTFAACRLKAVLHNLIPSLKASILAED--FANFGEIDSLYKEGLLLKLGFQDDMFKKFPLPKIVTTLQKSSEGLLRYDTPKIVSKD 420          
BLAST of FC931408 vs. ExPASy Swiss-Prot
Match: LOX23_HORVU (Lipoxygenase 2.3, chloroplastic OS=Hordeum vulgare GN=LOX2.3 PE=1 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 3.165e-58
Identity = 117/235 (49.79%), Postives = 158/235 (67.23%), Query Frame = 2
Query:    2 EMYLKDIVL--DGLPNGPVNVTCNSWLHSKHDNKQKRVFFTNKLYLPSQTPDGLKRYRAEELTILRGNGQGERKTYDRIYDYDVYNDLGDPDKKPELARPVLGGKQNPYPRRCRTGRPRCDTDQFSEKREGNFYVPRDEAFSEVKQLTFSAKTVYSVLHALVPSLETAFVDPDLGFPYFSAIDALFNEGVNLPPLKQEG----FWNTLLPRLVKAIEDTGDNILLFETPETMDRD 688
            EM++KDI L   G  +  +     SW+HSK D+ + R FFT K YLPSQTP G++  R +EL  LRG+G  ERK ++R+YDYD YNDLGDPDK  +  RPVLG K++PYPRRCRTGRP+   D  +E R    YVPRDE FS+VK  TFSA T+ S LHA++P++    ++   GF +F AIDAL+++G+ LP     G      N ++PR+V+ IEDT +++L FE PE ++RD
Sbjct:  159 EMFIKDIKLITGGDESTAITFDVASWVHSKFDDPEPRAFFTVKSYLPSQTPPGIEALRKKELETLRGDGHSERKFHERVYDYDTYNDLGDPDKNIDHKRPVLGTKEHPYPRRCRTGRPKTLYDPETETRSSPVYVPRDEQFSDVKGRTFSATTLRSGLHAILPAV-APLLNNSHGFSHFPAIDALYSDGIPLPVDGHGGNSFNVINDVIPRVVQMIEDTTEHVLRFEVPEMLERD 392          
BLAST of FC931408 vs. ExPASy Swiss-Prot
Match: LOXC1_ORYSJ (Lipoxygenase 7, chloroplastic OS=Oryza sativa subsp. japonica GN=CM-LOX1 PE=2 SV=2)

HSP 1 Score: 222.631 bits (566), Expect = 1.571e-57
Identity = 124/242 (51.24%), Postives = 155/242 (64.05%), Query Frame = 2
Query:    2 EMYLKDIVL---DGLPNGPV-NVTCNSWLHSK----HDNKQKRVFFTNKLYLPSQTPDGLKRYRAEELTILRGNGQGERKTYDRIYDYDVYNDLGDPDKKPELARPVLGG-KQNPYPRRCRTGRPRCDTDQFSEKREGNFYVPRDEAFSEVKQLTFSAKTVYSVLHALVPSLETAFVDP---DLGFPYFSAIDALFNEGVNLPPLKQEGFWNTLLPRLVKAIEDT-GDNILLFETPETMDRD 688
            EM+L+DI L   DG  N  V  + CNSW+  K         KR+FF NK YLP QTP GL+ YR  +L   RG+G GER+  DR+YDYDVYNDLG+PD   +LARPVLGG KQ PYPRRCRTGRP    D  SE R+GN YVPRDE FS  K+  F  KTV SVL A VP+ ++  +D    +L FP F  ID LF +GV LP + +  F  +++PRL++ + DT  + IL FETP  + +D
Sbjct:  176 EMFLEDINLTASDGAGNSTVLPIRCNSWVQPKSVGDEGTPSKRIFFANKTYLPGQTPAGLRSYRKNDLQQKRGDGTGEREADDRVYDYDVYNDLGNPDSNGDLARPVLGGNKQFPYPRRCRTGRPPSKKDPKSETRKGNVYVPRDEEFSPEKEDYFLRKTVGSVLQAAVPAAQSLLLDKLKWNLPFPSFFVIDKLFEDGVELPGVDKLNFLESVVPRLLEHLRDTPAEKILRFETPANIQKD 417          
BLAST of FC931408 vs. ExPASy Swiss-Prot
Match: LOX6_ORYSJ (Probable lipoxygenase 6 OS=Oryza sativa subsp. japonica GN=Os03g0179900 PE=2 SV=2)

HSP 1 Score: 211.846 bits (538), Expect = 2.773e-54
Identity = 112/234 (47.86%), Postives = 150/234 (64.10%), Query Frame = 2
Query:    2 EMYLKDIVLDG--LPNGPVNVTCNSWLHSKHDNKQKRVFFTNKLYLPSQTPDGLKRYRAEELTILRGNGQGERKTYDRIYDYDVYNDLGDPDKKPELARPVLGGKQNPYPRRCRTGRPRCDTDQFSEKREGN---FYVPRDEAFSEVKQLTFSAKTVYSVLHALVPSLETAFVDPDLGFPYFSAIDALFNEGVNLPPLKQEGFWNTLLPRLVKAIEDTGDNILLFETPETMDRD 688
            E +L+ IV++G  LP GPV+  CNSW+ S  +   KRVFF+NK YLPS+TP GL+  R +EL  LRG+G G RK  DRIYDY  YNDLG+PDK  E  RP+LGG++ PYPRRCRTGRP  DT+  +E R       YVPRDEAF E+KQ  FS+  + +VLH L+PSL  +       F  F  ID L+ EG+ L    QE  +  +   LV+ I+++ + +L ++TP  + +D
Sbjct:  178 EFFLESIVVEGGGLPCGPVHFACNSWVQSTRELPTKRVFFSNKPYLPSETPPGLRELREKELKDLRGDGTGVRKLSDRIYDYATYNDLGNPDKGKEFIRPILGGEKIPYPRRCRTGRPPTDTNMLAESRVEKPHPIYVPRDEAFEELKQGAFSSGRLRAVLHTLIPSLIASISAETHNFQGFHHIDNLYKEGLRLKLGLQEHLFQKI--PLVQKIQESSEGMLRYDTPSILSKD 409          
BLAST of FC931408 vs. ExPASy Swiss-Prot
Match: LOX3_ARATH (Lipoxygenase 3, chloroplastic OS=Arabidopsis thaliana GN=LOX3 PE=2 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.376e-53
Identity = 110/236 (46.61%), Postives = 155/236 (65.68%), Query Frame = 2
Query:    2 EMYLKDIVLDGLPNGPVNVTCNSWLHSKHDNKQKRVFFTNKLYLPSQTPDGLKRYRAEELTILRGNGQGERKTYDRIYDYDVYNDLGDPDKKPELARPVLGGKQNPYPRRCRTGRPRCDTDQFSEKREGN---FYVPRDEAFSEVKQLTFSAKTVYSVLHALVPSLETAFVDPDLGFPYFSAIDALFNEGVNLPPLKQEGFWNTL-LPR-LVKAIEDTGDNILLFETPETMDRDNS 694
            E +L+ I ++G   GPV+  CNSW+ S+ D+  KR+FFTN+ YLP++TP GL+  R +EL  LRG+G G RK  DRIYD+DVYNDLG+PDK  EL+RP LGGK+ PYPRRCRTGR    +D+ +E R       YVPRDE F E KQ TF+A  + +VLH L+PSL+ + V  D  F  F  ID L+ EG+ L    Q+  +    LP+ +V  ++++   +L ++TP+ + +D +
Sbjct:  184 EFFLESITIEGFALGPVHFPCNSWVQSQKDHPDKRIFFTNQPYLPNETPSGLRVLREKELKNLRGDGSGVRKLSDRIYDFDVYNDLGNPDKSSELSRPKLGGKEVPYPRRCRTGRQSTVSDKDAESRVEKPLPMYVPRDEQFEESKQDTFAAGRLKAVLHHLIPSLKASIVAED--FADFGEIDRLYKEGLLLKLGFQDDIFKKFPLPKVVVDTLQESTKGLLKYDTPKILSKDKN 417          
BLAST of FC931408 vs. ExPASy Swiss-Prot
Match: LOX5_ORYSJ (Putative lipoxygenase 5 OS=Oryza sativa subsp. japonica GN=Os04g0447100 PE=3 SV=2)

HSP 1 Score: 198.364 bits (503), Expect = 3.173e-50
Identity = 103/233 (44.21%), Postives = 144/233 (61.80%), Query Frame = 2
Query:    2 EMYLKDIVLDGLPNGPVNVTCNSWLHSKHDNKQKRVFFTNKLYLPSQTPDGLKRYRAEELTILRGNGQGERKTYDRIYDYDVYNDLGDPDKKPELARPVLGGKQNPYPRRCRTGRPRCDTDQFSEKR---EGNFYVPRDEAFSEVKQLTFSAKTVYSVLHALVPSLETAFVDPDL-GFPYFSAIDALFNEGVNLPPLKQEGFWNTLLPRLVKAIEDTGDNILLFETPETMDRD 688
            E Y++ IV++G P GP + TCNSW+     ++ +RVFF+N+ YLPS+TP GL+  R  EL  LRG+G GER+  DR+YDYDVYNDLG+PDK    ARPVLGG+Q PYPRR RTGRP   TD  +E R       YV RDE F E K    S   + ++LH  +P L ++ V PD+  F  F  +D LF EG+ L     +  +  +    V+ I++  + +L ++TP+ + +D
Sbjct:  166 EFYIESIVVEGFPTGPAHFTCNSWVQPTRVSRDRRVFFSNRPYLPSETPPGLRELRLRELADLRGDGTGERRITDRVYDYDVYNDLGNPDKGVASARPVLGGEQMPYPRRMRTGRPSTATDASAESRVEYPEPIYVSRDEEFEEGKNEMLSEGAIKALLHNFMPLLVSS-VSPDIRDFAGFHDVDNLFKEGLRLKQALHDQLFQKI--PFVRKIQENSEGLLRYDTPDIIKKD 395          
BLAST of FC931408 vs. ExPASy Swiss-Prot
Match: LOX21_HORVU (Lipoxygenase 2.1, chloroplastic OS=Hordeum vulgare GN=LOX2.1 PE=1 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 1.741e-48
Identity = 118/246 (47.97%), Postives = 138/246 (56.10%), Query Frame = 2
Query:    2 EMYLKDIVL--DGLPNGPVNVTCNSWLHSKHDNKQKRVFFTNKLYLPSQTPDGLKRYRAEELTILRGNGQGERKTYDRIYDYDVYNDLGDP-DKKPELARPVLGGKQNPYPRRCRTGRPRCDTDQFSEKR--EGNFYVPRDEAFSEVKQLTFSAKTVYSVLHALVPSLETAFVDPDLGFPYFSAIDALFNEGVNLPPLKQEG--------FWNTLLPRLVK----AIEDTGDNILLFETPETMDRD 688
            EM L DI +   G     V   C SW+   H    KRVFF    YLPSQTP G++  R  EL ILRG G GERK +DRIYDYDVYNDLG+P D      RPVLGGK++PYPRRCRTGRPR   D FSE+R  + + YVPRDEAF+E K   F  K   S LHAL   L+TA       FP  SAID L+++     P++ EG           T L  L K    A  +    +  FETPE  DRD
Sbjct:  177 EMLLGDIEVFPTGQEESAVTFHCKSWIDPSHCTPDKRVFFPAHSYLPSQTPKGVEGLRKRELEILRGTGCGERKEHDRIYDYDVYNDLGNPDDDNNPTTRPVLGGKEHPYPRRCRTGRPRSKKDPFSEERSHKEHIYVPRDEAFTERKMGAFDTKKFMSQLHALTTGLKTA-KHKSQSFPSLSAIDQLYDDNFRNQPVQPEGGKLRFVIDLLETELLHLFKLEGAAFLEGIRRVFKFETPEIHDRD 421          
BLAST of FC931408 vs. ExPASy Swiss-Prot
Match: LOXB_PHAVU (Lipoxygenase (Fragment) OS=Phaseolus vulgaris PE=2 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 3.283e-47
Identity = 103/234 (44.02%), Postives = 136/234 (58.12%), Query Frame = 2
Query:    2 EMYLKDIVLDGLPN-GPVNVTCNSWLHSKHDNKQKRVFFTNKLYLPSQTPDGLKRYRAEELTILRGNGQGERKTYDRIYDYDVYNDLGDPDKKPELARPVLGGKQNPYPRRCRTGRPRCDTDQFSEKREGNFYVPRDEAFSEVKQLTFSAKTVYSVLHALVPSLETAFVDP--DLGFPYFSAIDALFNEGVNLPPLKQEGFWNTLLPRLVKAIEDTGDNILLFETPETMDRDNS 694
            E YLK + L+ +PN G ++  CNSW+++    K  R+FF N  YLPS+TP  L +YR EEL  +RG+G GERK +DR+YDYDVYNDLG+PDK   LARPVLGG   PYPRR RTGRP+   D  SEK     Y+PRDEAF  +K   F A  + SV   ++P L  AF      L F  F+ +  L+  GV LP      +    +P + +     G+  L +  P+ M  + S
Sbjct:   14 EFYLKSLTLEDIPNHGTIHFICNSWIYNSKVYKSDRIFFANNTYLPSETPAPLLKYREEELKNVRGDGSGERKEWDRVYDYDVYNDLGNPDKGAALARPVLGGSTLPYPRRGRTGRPKTKKDPNSEKPSDFVYLPRDEAFGHLKSSDFLAYGLKSVSQDVLPVLTDAFDGNLLSLEFDNFAEVHKLYEGGVTLPTNFLSKY--APIPIVKEIFRSDGEQFLKYPPPKVMQVNKS 245          
The following BLAST results are available for this feature:
BLAST of FC931408 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 31
Match NameE-valueIdentityDescription
LOXC2_ORYSJ2.342e-6152.89Probable lipoxygenase 8, chloroplastic OS=Oryza sa... [more]
LOX2_ARATH2.863e-5949.79Lipoxygenase 2, chloroplastic OS=Arabidopsis thali... [more]
LOX4_ARATH3.165e-5848.50Lipoxygenase 4, chloroplastic OS=Arabidopsis thali... [more]
LOX23_HORVU3.165e-5849.79Lipoxygenase 2.3, chloroplastic OS=Hordeum vulgare... [more]
LOXC1_ORYSJ1.571e-5751.24Lipoxygenase 7, chloroplastic OS=Oryza sativa subs... [more]
LOX6_ORYSJ2.773e-5447.86Probable lipoxygenase 6 OS=Oryza sativa subsp. jap... [more]
LOX3_ARATH1.376e-5346.61Lipoxygenase 3, chloroplastic OS=Arabidopsis thali... [more]
LOX5_ORYSJ3.173e-5044.21Putative lipoxygenase 5 OS=Oryza sativa subsp. jap... [more]
LOX21_HORVU1.741e-4847.97Lipoxygenase 2.1, chloroplastic OS=Hordeum vulgare... [more]
LOXB_PHAVU3.283e-4744.02Lipoxygenase (Fragment) OS=Phaseolus vulgaris PE=2... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34104G09EF PostHarvP1 Citrus clementina cDNA clone C34104G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931408 ID=FC931408|Name=FC931408|organism=Citrus clementina|type=EST|length=700bp
AGAGATGTATTTGAAAGATATTGTTCTTGATGGTTTGCCAAATGGTCCTG
TCAACGTAACATGTAATTCATGGCTTCACTCAAAGCACGACAATAAACAA
AAGAGAGTTTTCTTTACCAACAAGTTGTACTTGCCATCACAAACACCAGA
CGGATTGAAGAGATATAGAGCTGAGGAGCTTACCATTTTGCGAGGTAATG
GACAAGGAGAGCGCAAAACCTATGATAGAATCTATGATTATGATGTCTAC
AATGATCTTGGAGATCCAGACAAGAAACCTGAATTAGCAAGGCCTGTGCT
TGGAGGCAAACAAAACCCTTATCCTAGACGTTGCAGAACTGGACGCCCAC
GGTGTGACACAGATCAATTTTCGGAGAAAAGAGAGGGAAACTTTTATGTT
CCAAGGGATGAAGCATTCTCGGAGGTAAAGCAGCTAACATTTTCAGCAAA
GACGGTGTACTCAGTGTTGCATGCGTTGGTACCATCCTTAGAAACCGCCT
TTGTCGATCCTGATCTGGGGTTTCCATACTTCTCTGCTATTGACGCACTC
TTCAATGAAGGAGTCAACTTGCCTCCACTCAAACAGGAAGGTTTTTGGAA
CACACTGCTTCCCAGATTGGTTAAGGCAATTGAGGATACAGGAGATAATA
TTTTGCTGTTTGAGACGCCAGAAACAATGGACAGAGACAATTCTTTTGGT
back to top