FC931412

Overview
NameFC931412
Unique NameFC931412
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length736
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15297 contig Ccv1_Contig15297:1..736. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931412 vs. ExPASy Swiss-Prot
Match: ADT_NEUCR (ADP,ATP carrier protein OS=Neurospora crassa GN=acp PE=3 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 1.627e-108
Identity = 194/244 (79.51%), Postives = 209/244 (85.66%), Query Frame = 2
Query:    2 GGVSAAVSKTAAAPIERIKLLIQNQDEMLKQGRLDRKYNGIADCFRRTAAAEGVVSLWRGNTANVIRYFPTQALNFAFRDTYKSMFAYKKDRDGYAKWMMXXXXXXXXXXXXXXXFVYSLDYARTRLANDAKSSKGSGERQFNGLVDVYRKTLASDGIAGLYRGFGPSVLGIVVYRGLYFGMYDSIKPVLLVGPLEGSFLASFLLGWTVTTGAGVASYPLDTVRRRMMMTSGEAVKYSSSLDAA 733
            GGVSAAVSKTAAAPIERIKLL+QNQDEM++ GRLDR+YNGI DCF+RT A EGV++LWRGNTANVIRYFPTQALNFAFRD +K MF YKKD DGY KWM                FVYSLDYARTRLANDAKS+K  GERQFNGLVDVYRKT+ASDGIAGLYRGFGPSV GIVVYRGLYFG+YDSIKPVLLVG L+ +FLASF LGW VTT AG+ASYPLDT+RRRMMMTSGEAVKY SS DAA
Sbjct:   20 GGVSAAVSKTAAAPIERIKLLVQNQDEMIRAGRLDRRYNGIIDCFKRTTADEGVMALWRGNTANVIRYFPTQALNFAFRDKFKKMFGYKKDVDGYWKWMAGNLASGGAAGATSLLFVYSLDYARTRLANDAKSAKKGGERQFNGLVDVYRKTIASDGIAGLYRGFGPSVAGIVVYRGLYFGLYDSIKPVLLVGDLKNNFLASFALGWCVTTAAGIASYPLDTIRRRMMMTSGEAVKYKSSFDAA 263          
BLAST of FC931412 vs. ExPASy Swiss-Prot
Match: ADT_SCHPO (ADP,ATP carrier protein OS=Schizosaccharomyces pombe GN=anc1 PE=2 SV=1)

HSP 1 Score: 391.349 bits (1004), Expect = 2.776e-108
Identity = 189/245 (77.14%), Postives = 210/245 (85.71%), Query Frame = 2
Query:    2 GGVSAAVSKTAAAPIERIKLLIQNQDEMLKQGRLDRKYNGIADCFRRTAAAEGVVSLWRGNTANVIRYFPTQALNFAFRDTYKSMFAYKKDRDGYAKWMMXXXXXXXXXXXXXXXFVYSLDYARTRLANDAKSSKGSGERQFNGLVDVYRKTLASDGIAGLYRGFGPSVLGIVVYRGLYFGMYDSIKPVLLVGPLEGSFLASFLLGWTVTTGAGVASYPLDTVRRRMMMTSGEAVKYSSSLDAAR 736
            GGVSAAVSKTAAAPIER+KLLIQNQDEM++ GRL  +Y GI +CF+RTAA EGV+SLWRGNTANV+RYFPTQALNFAF+D +K MF YKK+RDGYAKW                 FVYSLDYARTRLANDAKS+K  GERQFNGLVDVYRKT  SDG+ GLYRGFGPSV+GIVVYRGLYFGMYD++KPV+LVGPLEG+FLASFLLGW VTTG+GVASYPLDT+RRRMMMTSGEAVKYSSS +  R
Sbjct:   34 GGVSAAVSKTAAAPIERVKLLIQNQDEMIRAGRLSHRYKGIGECFKRTAAEEGVISLWRGNTANVLRYFPTQALNFAFKDKFKKMFGYKKERDGYAKWFAGNLASGGAAGAASLLFVYSLDYARTRLANDAKSAKKGGERQFNGLVDVYRKTYRSDGLRGLYRGFGPSVVGIVVYRGLYFGMYDTLKPVVLVGPLEGNFLASFLLGWAVTTGSGVASYPLDTIRRRMMMTSGEAVKYSSSFECGR 278          
BLAST of FC931412 vs. ExPASy Swiss-Prot
Match: ADT_KLULA (ADP,ATP carrier protein OS=Kluyveromyces lactis GN=AAC PE=3 SV=1)

HSP 1 Score: 369.392 bits (947), Expect = 1.130e-101
Identity = 184/245 (75.10%), Postives = 204/245 (83.27%), Query Frame = 2
Query:    2 GGVSAAVSKTAAAPIERIKLLIQNQDEMLKQGRLDRKYNGIADCFRRTAAAEGVVSLWRGNTANVIRYFPTQALNFAFRDTYKSMFAYKKDRDGYAKWMMXXXXXXXXXXXXXXXFVYSLDYARTRLANDAKSSKGSGERQFNGLVDVYRKTLASDGIAGLYRGFGPSVLGIVVYRGLYFGMYDSIKPVLLVGPLEGSFLASFLLGWTVTTGAGVASYPLDTVRRRMMMTSGEAVKYSSSLDAAR 736
            GGVSAAVSKTAAAPIER+KLLIQNQDEM+KQG LDR+Y GI +CF+RTAA EGV S WRGNTANVIRYFPTQALNFAF+D  K+MF +KK+ +GYAKW                 FVYSLDYARTRLA D+KS+K  GERQFNGLVDVY+KTLASDG+AGLYRGF PSV+GIVVYRGLYFG+YDS+KP+LL G LE SFLASFLLGW VTTGA  ASYPLDTVRRRMMMTSG+AVKY  + DA R
Sbjct:   17 GGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIVECFKRTAADEGVASFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKE-EGYAKWFAGNLASGGLAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGLYRGFLPSVVGIVVYRGLYFGLYDSLKPLLLTGSLENSFLASFLLGWAVTTGASTASYPLDTVRRRMMMTSGQAVKYDGAFDAFR 260          
BLAST of FC931412 vs. ExPASy Swiss-Prot
Match: ADT2_YEAST (ADP,ATP carrier protein 2 OS=Saccharomyces cerevisiae GN=AAC2 PE=1 SV=2)

HSP 1 Score: 366.696 bits (940), Expect = 7.322e-101
Identity = 182/245 (74.29%), Postives = 201/245 (82.04%), Query Frame = 2
Query:    2 GGVSAAVSKTAAAPIERIKLLIQNQDEMLKQGRLDRKYNGIADCFRRTAAAEGVVSLWRGNTANVIRYFPTQALNFAFRDTYKSMFAYKKDRDGYAKWMMXXXXXXXXXXXXXXXFVYSLDYARTRLANDAKSSKGSGERQFNGLVDVYRKTLASDGIAGLYRGFGPSVLGIVVYRGLYFGMYDSIKPVLLVGPLEGSFLASFLLGWTVTTGAGVASYPLDTVRRRMMMTSGEAVKYSSSLDAAR 736
            GGVSAAV+KTAA+PIER+KLLIQNQDEMLKQG LDRKY GI DCF+RTA  EGV+S WRGNTANVIRYFPTQALNFAF+D  K+MF +KK+ +GYAKW                 FVYSLDYARTRLA D+KSSK  G RQFNGL+DVY+KTL SDG+AGLYRGF PSV+GIVVYRGLYFGMYDS+KP+LL G LEGSFLASFLLGW VTTGA   SYPLDTVRRRMMMTSG+AVKY  + D  R
Sbjct:   30 GGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKE-EGYAKWFAGNLASGGAAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTGSLEGSFLASFLLGWVVTTGASTCSYPLDTVRRRMMMTSGQAVKYDGAFDCLR 273          
BLAST of FC931412 vs. ExPASy Swiss-Prot
Match: ADT2_MAIZE (ADP,ATP carrier protein 2, mitochondrial OS=Zea mays GN=ANT2 PE=2 SV=2)

HSP 1 Score: 365.925 bits (938), Expect = 1.249e-100
Identity = 180/243 (74.07%), Postives = 199/243 (81.89%), Query Frame = 2
Query:    2 GGVSAAVSKTAAAPIERIKLLIQNQDEMLKQGRLDRKYNGIADCFRRTAAAEGVVSLWRGNTANVIRYFPTQALNFAFRDTYKSMFAYKKDRDGYAKWMMXXXXXXXXXXXXXXXFVYSLDYARTRLANDAKSSKGSGERQFNGLVDVYRKTLASDGIAGLYRGFGPSVLGIVVYRGLYFGMYDSIKPVLLVGPLEGSFLASFLLGWTVTTGAGVASYPLDTVRRRMMMTSGEAVKYSSSLDA 730
            GGVSAAVSKTAAAPIER+KLLIQNQDEM+K GRL   Y GIADCF+RT   EG  SLWRGNTANVIRYFPTQALNFAF+D +K +F +KKDRDGY KW                 FVYSLDYARTRLANDAK++KG G+RQFNGLVDVYRKTL SDGIAGLYRGF  S +GI+VYRGLYFG+YDSIKPV+L G L+ +F ASF LGW +T GAG+ASYP+DTVRRRMMMTSGEAVKY SSLDA
Sbjct:   94 GGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGIADCFKRTIKDEGFSSLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDAKAAKGGGDRQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSIKPVVLTGSLQDNFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDA 336          
BLAST of FC931412 vs. ExPASy Swiss-Prot
Match: ADT1_MAIZE (ADP,ATP carrier protein 1, mitochondrial OS=Zea mays GN=ANT1 PE=2 SV=3)

HSP 1 Score: 365.155 bits (936), Expect = 2.130e-100
Identity = 180/243 (74.07%), Postives = 198/243 (81.48%), Query Frame = 2
Query:    2 GGVSAAVSKTAAAPIERIKLLIQNQDEMLKQGRLDRKYNGIADCFRRTAAAEGVVSLWRGNTANVIRYFPTQALNFAFRDTYKSMFAYKKDRDGYAKWMMXXXXXXXXXXXXXXXFVYSLDYARTRLANDAKSSKGSGERQFNGLVDVYRKTLASDGIAGLYRGFGPSVLGIVVYRGLYFGMYDSIKPVLLVGPLEGSFLASFLLGWTVTTGAGVASYPLDTVRRRMMMTSGEAVKYSSSLDA 730
            GGVSAAVSKTAAAPIER+KLLIQNQDEM+K GRL   Y GI DCF+RT   EG  SLWRGNTANVIRYFPTQALNFAF+D +K +F +KKDRDGY KW                 FVYSLDYARTRLANDAK++KG GERQFNGLVDVYRKTL SDGIAGLYRGF  S +GI+VYRGLYFG+YDSIKPV+L G L+ +F ASF LGW +T GAG+ASYP+DTVRRRMMMTSGEAVKY SSLDA
Sbjct:   94 GGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGIVDCFKRTIKDEGFSSLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDAKAAKGGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSIKPVVLTGNLQDNFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDA 336          
BLAST of FC931412 vs. ExPASy Swiss-Prot
Match: ADT1_WHEAT (ADP,ATP carrier protein 1, mitochondrial OS=Triticum aestivum GN=ANT-G1 PE=3 SV=1)

HSP 1 Score: 362.459 bits (929), Expect = 1.381e-99
Identity = 181/243 (74.49%), Postives = 196/243 (80.66%), Query Frame = 2
Query:    2 GGVSAAVSKTAAAPIERIKLLIQNQDEMLKQGRLDRKYNGIADCFRRTAAAEGVVSLWRGNTANVIRYFPTQALNFAFRDTYKSMFAYKKDRDGYAKWMMXXXXXXXXXXXXXXXFVYSLDYARTRLANDAKSSKGSGERQFNGLVDVYRKTLASDGIAGLYRGFGPSVLGIVVYRGLYFGMYDSIKPVLLVGPLEGSFLASFLLGWTVTTGAGVASYPLDTVRRRMMMTSGEAVKYSSSLDA 730
            GGVSAAVSKTAAAPIER+KLLIQNQDEM+K GRL   Y GI DCF RT   EG  SLWRGNTANVIRYFPTQALNFAF+D +K MF +KKD+DGY KW                 FVYSLDYARTRLANDAK+SKG GERQFNGLVDVYRKTL SDGIAGLYRGF  S +GI+VYRGLYFG+YDS+KPVLL G L+  F ASF LGW +T GAG+ASYP+DTVRRRMMMTSGEAVKY SSLDA
Sbjct:   38 GGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQALNFAFKDYFKRMFNFKKDKDGYWKWFGGNLASGGAAGASSLFFVYSLDYARTRLANDAKASKGGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGLYDSLKPVLLTGTLQVCFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDA 280          
BLAST of FC931412 vs. ExPASy Swiss-Prot
Match: ADT_ORYSJ (ADP,ATP carrier protein, mitochondrial OS=Oryza sativa subsp. japonica GN=Os02g0718900 PE=2 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 1.804e-99
Identity = 178/243 (73.25%), Postives = 197/243 (81.07%), Query Frame = 2
Query:    2 GGVSAAVSKTAAAPIERIKLLIQNQDEMLKQGRLDRKYNGIADCFRRTAAAEGVVSLWRGNTANVIRYFPTQALNFAFRDTYKSMFAYKKDRDGYAKWMMXXXXXXXXXXXXXXXFVYSLDYARTRLANDAKSSKGSGERQFNGLVDVYRKTLASDGIAGLYRGFGPSVLGIVVYRGLYFGMYDSIKPVLLVGPLEGSFLASFLLGWTVTTGAGVASYPLDTVRRRMMMTSGEAVKYSSSLDA 730
            GGVSAAVSKTAAAPIER+KLLIQNQDEM+K GRL   Y GI DCF RT   EG  SLWRGNTANVIRYFPTQALNFAF+D +K +F +KKD+DGY KW                 FVYSLDYARTRLANDAK++KG GERQFNGLVDVYRKTL SDGIAGLYRGF  S +GI+VYRGLYFGMYDS+KPV+L G L+ +F ASF LGW +T GAG+ASYP+DTVRRRMMMTSGEAVKY SS+DA
Sbjct:   89 GGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEGFASLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDKDGYWKWFGGNLASGGAAGASSLFFVYSLDYARTRLANDAKAAKGGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVLTGSLQDNFFASFALGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSMDA 331          
BLAST of FC931412 vs. ExPASy Swiss-Prot
Match: ADT1_GOSHI (ADP,ATP carrier protein 1, mitochondrial OS=Gossypium hirsutum GN=ANT1 PE=2 SV=1)

HSP 1 Score: 360.918 bits (925), Expect = 4.018e-99
Identity = 178/243 (73.25%), Postives = 197/243 (81.07%), Query Frame = 2
Query:    2 GGVSAAVSKTAAAPIERIKLLIQNQDEMLKQGRLDRKYNGIADCFRRTAAAEGVVSLWRGNTANVIRYFPTQALNFAFRDTYKSMFAYKKDRDGYAKWMMXXXXXXXXXXXXXXXFVYSLDYARTRLANDAKSSKGSGERQFNGLVDVYRKTLASDGIAGLYRGFGPSVLGIVVYRGLYFGMYDSIKPVLLVGPLEGSFLASFLLGWTVTTGAGVASYPLDTVRRRMMMTSGEAVKYSSSLDA 730
            GGVSAAVSKTAAAPIER+KLLIQNQDEM+K GRL   Y GI DCF+RT   EG  SLWRGNTANVIRYFPTQALNFAF+D +K +F +KKDRDGY KW                 FVYSLDYARTRLANDAK++K  GERQFNGLVDVYRKTL SDGIAGLYRGF  S +GI+VYRGLYFGMYDS+KPVLL G ++ SF ASF+LGW +T GA +ASYP+DTVRRRMMMTSG+AVKY SSLDA
Sbjct:   93 GGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGIGDCFKRTIKDEGFGSLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDAKAAKKGGERQFNGLVDVYRKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLLTGSMQDSFFASFVLGWLITNGAALASYPIDTVRRRMMMTSGKAVKYKSSLDA 335          
BLAST of FC931412 vs. ExPASy Swiss-Prot
Match: ADT1_SOLTU (ADP,ATP carrier protein, mitochondrial OS=Solanum tuberosum GN=ANT PE=2 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 1.527e-98
Identity = 180/243 (74.07%), Postives = 195/243 (80.25%), Query Frame = 2
Query:    2 GGVSAAVSKTAAAPIERIKLLIQNQDEMLKQGRLDRKYNGIADCFRRTAAAEGVVSLWRGNTANVIRYFPTQALNFAFRDTYKSMFAYKKDRDGYAKWMMXXXXXXXXXXXXXXXFVYSLDYARTRLANDAKSSKGSGERQFNGLVDVYRKTLASDGIAGLYRGFGPSVLGIVVYRGLYFGMYDSIKPVLLVGPLEGSFLASFLLGWTVTTGAGVASYPLDTVRRRMMMTSGEAVKYSSSLDA 730
            GGVSAAVSKTAAAPIER+KLLIQNQDEMLK GRL   Y GI +CF RT   EG  SLWRGNTANVIRYFPTQALNFAF+D +K +F +KKDRDGY KW                 FVYSLDYARTRLAND K+SK  GERQFNGLVDVY+KTL SDGIAGLYRGF  S +GI+VYRGLYFGMYDS+KPVLL G L+ SF ASF LGW +T GAG+ASYP+DTVRRRMMMTSGEAVKY SSLDA
Sbjct:   93 GGVSAAVSKTAAAPIERVKLLIQNQDEMLKAGRLSEPYKGIGECFGRTIKEEGFGSLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLFFVYSLDYARTRLANDRKASKKGGERQFNGLVDVYKKTLKSDGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLLTGNLQDSFFASFGLGWLITNGAGLASYPIDTVRRRMMMTSGEAVKYKSSLDA 335          
The following BLAST results are available for this feature:
BLAST of FC931412 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 98
Match NameE-valueIdentityDescription
ADT_NEUCR1.627e-10879.51ADP,ATP carrier protein OS=Neurospora crassa GN=ac... [more]
ADT_SCHPO2.776e-10877.14ADP,ATP carrier protein OS=Schizosaccharomyces pom... [more]
ADT_KLULA1.130e-10175.10ADP,ATP carrier protein OS=Kluyveromyces lactis GN... [more]
ADT2_YEAST7.322e-10174.29ADP,ATP carrier protein 2 OS=Saccharomyces cerevis... [more]
ADT2_MAIZE1.249e-10074.07ADP,ATP carrier protein 2, mitochondrial OS=Zea ma... [more]
ADT1_MAIZE2.130e-10074.07ADP,ATP carrier protein 1, mitochondrial OS=Zea ma... [more]
ADT1_WHEAT1.381e-9974.49ADP,ATP carrier protein 1, mitochondrial OS=Tritic... [more]
ADT_ORYSJ1.804e-9973.25ADP,ATP carrier protein, mitochondrial OS=Oryza sa... [more]
ADT1_GOSHI4.018e-9973.25ADP,ATP carrier protein 1, mitochondrial OS=Gossyp... [more]
ADT1_SOLTU1.527e-9874.07ADP,ATP carrier protein, mitochondrial OS=Solanum ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34104H01EF PostHarvP1 Citrus clementina cDNA clone C34104H01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931412 ID=FC931412|Name=FC931412|organism=Citrus clementina|type=EST|length=736bp
GGGTGGTGTCTCCGCCGCTGTCTCTAAGACCGCTGCTGCCCCCATTGAGC
GTATCAAGCTCCTGATCCAGAACCAGGATGAGATGCTCAAGCAGGGTCGC
CTCGACCGCAAGTACAACGGTATTGCTGACTGCTTCCGCCGTACCGCCGC
CGCTGAGGGTGTTGTCTCCTTGTGGCGTGGTAACACCGCCAACGTCATCC
GTTACTTCCCCACTCAGGCCCTGAACTTCGCTTTCCGCGACACCTACAAG
TCCATGTTCGCCTACAAGAAGGACCGTGATGGATACGCCAAGTGGATGAT
GGGTAACCTTGCCTCCGGTGGTGCCGCCGGTGCCACTTCCCTCCTGTTCG
TCTACTCCCTGGACTACGCCCGTACCCGTCTGGCCAACGATGCCAAGTCC
TCCAAGGGCTCCGGTGAGCGCCAGTTCAACGGTCTCGTCGATGTTTACCG
CAAGACCCTCGCCTCCGACGGTATTGCCGGTCTCTACCGTGGCTTCGGTC
CCTCCGTTCTCGGAATTGTCGTCTACCGTGGTCTCTACTTCGGAATGTAC
GATTCCATCAAGCCCGTCCTCCTCGTTGGTCCTCTTGAGGGCTCTTTCCT
CGCCTCCTTCCTGCTCGGCTGGACCGTCACCACCGGTGCCGGTGTTGCCT
CTTACCCTCTTGACACCGTTCGCCGTCGCATGATGATGACCTCTGGTGAG
GCCGTCAAGTACTCCAGCTCCCTGGATGCTGCCCGC
back to top