FC931413

Overview
NameFC931413
Unique NameFC931413
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length711
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig6173 contig Ccv1_Contig6173:447..1159. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931413 vs. ExPASy Swiss-Prot
Match: ALF_ORYSJ (Fructose-bisphosphate aldolase cytoplasmic isozyme OS=Oryza sativa subsp. japonica GN=FBA PE=1 SV=2)

HSP 1 Score: 371.318 bits (952), Expect = 8.742e-105
Identity = 183/219 (83.56%), Postives = 202/219 (92.24%), Query Frame = 1
Query:    7 TQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGPVPIVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAPKVTPDVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVXVQANSEATLGTYR 663
            TQG D L +RC KYYEAGARFAKWRAVLKIGPNEPSQLAI+ NA GLARYAIICQENG VPIVEPEILVDGPHDI++CA V+E VLAACYKALN+HHVLLEGTLLKPNMVTPGS+A KV+P+VIAE+TVR LQRT+PAAVPA+VFLSGGQSEEEAT NLNAMN+L TKKPWSLSFSFGRALQQSTLKAW+GK EN++KA+AAFL   +ANSEATLGTY+
Sbjct:  120 TQGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVPIVEPEILVDGPHDIDRCAYVSEVVLAACYKALNEHHVLLEGTLLKPNMVTPGSDAKKVSPEVIAEYTVRTLQRTVPAAVPAIVFLSGGQSEEEATLNLNAMNKLSTKKPWSLSFSFGRALQQSTLKAWSGKAENIEKARAAFLTRCKANSEATLGTYK 338          

HSP 2 Score: 30.8018 bits (68), Expect = 8.742e-105
Identity = 13/17 (76.47%), Postives = 16/17 (94.12%), Query Frame = 3
Query:  660 QGDAQLGEGAAESLHVR 710
            +GDA LGEGA+ESLHV+
Sbjct:  338 KGDAVLGEGASESLHVK 354          
BLAST of FC931413 vs. ExPASy Swiss-Prot
Match: ALF_MAIZE (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Zea mays PE=2 SV=1)

HSP 1 Score: 373.629 bits (958), Expect = 5.624e-103
Identity = 185/219 (84.47%), Postives = 202/219 (92.24%), Query Frame = 1
Query:    7 TQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGPVPIVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAPKVTPDVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVXVQANSEATLGTYR 663
            TQG D L +RC KYYEAGARFAKWRAVLKIGPNEPSQLAI+ NA GLARYAIICQENG VPIVEPEILVDGPHDI++CA VTE VLAACYKALN+HHVLLEGTLLKPNMVTPGS++ KVTP+VIAE+TVR LQRT+PAAVPAV+FLSGGQSEEEATRNLNAMN+L TKKPWSLSFSFGRALQ STLKAWAGK EN++KA+AAFL   +ANSEATLGTY+
Sbjct:  120 TQGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVPIVEPEILVDGPHDIDRCAYVTETVLAACYKALNEHHVLLEGTLLKPNMVTPGSDSKKVTPEVIAEYTVRTLQRTVPAAVPAVLFLSGGQSEEEATRNLNAMNKLSTKKPWSLSFSFGRALQASTLKAWAGKVENLEKARAAFLARCKANSEATLGTYK 338          
BLAST of FC931413 vs. ExPASy Swiss-Prot
Match: ALF_CICAR (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Cicer arietinum GN=ALDC PE=2 SV=1)

HSP 1 Score: 359.762 bits (922), Expect = 3.329e-101
Identity = 180/220 (81.82%), Postives = 198/220 (90.00%), Query Frame = 1
Query:    7 TQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAIN-ENANGLARYAIICQENGPVPIVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAPKVTPDVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVXVQANSEATLGTYR 663
            TQGLDGL  RC KYYEAGARFAKWRAVLKIGPNEPS   ++ ENA GLARYA+ICQENG VPIVE EILVDG HDI+KCA +TERVLAA YKAL+DHHVLLEGTLLKPNMVTPGS++PKV P+V+AEHTVRALQRT+PAAVPAVVFLSGGQSEEEAT NLNA+NQ+K KKPW+LSFSFGRALQQSTLKAW+GKEENV+ AQ A L   +ANSEATLGTY+
Sbjct:  120 TQGLDGLGARCAKYYEAGARFAKWRAVLKIGPNEPSLSILSIENAYGLARYAVICQENGLVPIVELEILVDGSHDIHKCAAITERVLAATYKALSDHHVLLEGTLLKPNMVTPGSDSPKVAPEVVAEHTVRALQRTVPAAVPAVVFLSGGQSEEEATVNLNAINQVKGKKPWTLSFSFGRALQQSTLKAWSGKEENVKNAQDALLTRAKANSEATLGTYK 339          

HSP 2 Score: 30.4166 bits (67), Expect = 3.329e-101
Identity = 12/17 (70.59%), Postives = 17/17 (100.00%), Query Frame = 3
Query:  660 QGDAQLGEGAAESLHVR 710
            +G++QLGEGA+ESLHV+
Sbjct:  339 KGNSQLGEGASESLHVK 355          
BLAST of FC931413 vs. ExPASy Swiss-Prot
Match: ALF2_PEA (Fructose-bisphosphate aldolase, cytoplasmic isozyme 2 OS=Pisum sativum PE=3 SV=1)

HSP 1 Score: 363.614 bits (932), Expect = 9.644e-101
Identity = 180/219 (82.19%), Postives = 198/219 (90.41%), Query Frame = 1
Query:    7 TQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGPVPIVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAPKVTPDVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVXVQANSEATLGTYR 663
            TQGLDGL  RC+KYYEAGARFAKWRAVLKIG NEPS+ +I+ENA GLARYA+ICQENG VPIVEPEILVDG HDI KCA +TERVLAA YKAL+DHHV+LEGTLLKPNMVTPGS+APKV P+VIAEHTVRALQRT+PAAVPAVVFLSGGQSEEEA+ NLNA+NQ+K KKPW+LSFSFGRALQQSTLKAW GK ENV+ AQ A L   +ANSEATLGTY+
Sbjct:  121 TQGLDGLGARCRKYYEAGARFAKWRAVLKIGANEPSEHSIHENAYGLARYAVICQENGLVPIVEPEILVDGSHDILKCAAITERVLAATYKALSDHHVILEGTLLKPNMVTPGSDAPKVAPEVIAEHTVRALQRTVPAAVPAVVFLSGGQSEEEASVNLNAINQIKGKKPWTLSFSFGRALQQSTLKAWGGKTENVKAAQDALLTRAKANSEATLGTYK 339          

HSP 2 Score: 25.0238 bits (53), Expect = 9.644e-101
Identity = 10/17 (58.82%), Postives = 14/17 (82.35%), Query Frame = 3
Query:  660 QGDAQLGEGAAESLHVR 710
            +G + LG GA+ESLHV+
Sbjct:  339 KGASNLGAGASESLHVK 355          
BLAST of FC931413 vs. ExPASy Swiss-Prot
Match: ALF_SPIOL (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 363.614 bits (932), Expect = 5.820e-100
Identity = 179/219 (81.74%), Postives = 196/219 (89.50%), Query Frame = 1
Query:    7 TQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGPVPIVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAPKVTPDVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVXVQANSEATLGTYR 663
            TQGLDGLAQRC +YY AGARFAKWRAVLKIGP EPS LAI ENANGLARY IICQENG VPIVEPEILVDG HDI++CA+V+ERVLAACYKALNDHHVLLEGT LKPN+VTPGSE+ KVTP+VIAE+TVR LQRT+P AVP V+FLSGGQSEEEAT NLNAMN+L+TKKPW+LSFS+GRALQQSTLKAW GKEENV KAQ  FL   + NSEATLG Y+
Sbjct:  120 TQGLDGLAQRCAQYYTAGARFAKWRAVLKIGPTEPSPLAILENANGLARYGIICQENGLVPIVEPEILVDGTHDIDRCAEVSERVLAACYKALNDHHVLLEGTSLKPNIVTPGSESKKVTPEVIAEYTVRTLQRTVPQAVPGVMFLSGGQSEEEATLNLNAMNKLETKKPWTLSFSYGRALQQSTLKAWQGKEENVAKAQEVFLARAKGNSEATLGKYQ 338          
BLAST of FC931413 vs. ExPASy Swiss-Prot
Match: ALF1_PEA (Fructose-bisphosphate aldolase, cytoplasmic isozyme 1 OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 342.428 bits (877), Expect = 1.388e-93
Identity = 168/218 (77.06%), Postives = 187/218 (85.78%), Query Frame = 1
Query:    7 TQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGPVPIVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAPKVTPDVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVXVQANSEATLGTY 660
            TQG D L  RCQ+YY+AGARFAKWRAVLKIGPNEPS+L+I +NA GLARYAIICQENG V  VEPEIL DG HDI KCA VTE VLAACYKALND HVLLEGTLLKPNMVTPGS++PKV+P+VI E+TV AL+RT+PAAVP +VFLSGGQSEE+AT NLNAMN+    KPW+LSFSFGRALQQSTLK W+GK+ENV KAQ  FL   +ANSEATLG Y
Sbjct:  120 TQGFDSLGARCQQYYKAGARFAKWRAVLKIGPNEPSELSIQQNAQGLARYAIICQENGLVLFVEPEILTDGSHDIAKCAAVTETVLAACYKALNDQHVLLEGTLLKPNMVTPGSDSPKVSPEVIGEYTVNALRRTVPAAVPGIVFLSGGQSEEQATLNLNAMNKFDVVKPWTLSFSFGRALQQSTLKTWSGKKENVGKAQDVFLARCKANSEATLGKY 337          
BLAST of FC931413 vs. ExPASy Swiss-Prot
Match: ALF_ARATH (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Arabidopsis thaliana GN=At4g26520 PE=2 SV=2)

HSP 1 Score: 316.235 bits (809), Expect = 1.066e-85
Identity = 157/218 (72.02%), Postives = 178/218 (81.65%), Query Frame = 1
Query:    7 TQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGPVPIVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAPKVTPDVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVXVQANSEATLGTY 660
            TQGLD L  RCQ+YYEAGARFAKWRA  KIG  EPS L+I E+A  LARYAIICQENG VPIVEPE+L  G HDI KCA VTE VLAA +KALN HHVLLEGTLLKPNMVTPGS++PKV P++IAE+TV AL+RT+P A+P +VFLSG Q EE+AT NLNAMN+L   KPW+L+FSFG ALQQS +KAWAGK ENV KAQA FL   +AN +ATLG Y
Sbjct:  120 TQGLDSLGARCQQYYEAGARFAKWRAFFKIGATEPSVLSIQEDARVLARYAIICQENGLVPIVEPEVLTGGSHDIKKCAAVTETVLAAVFKALNYHHVLLEGTLLKPNMVTPGSDSPKVAPELIAEYTVTALRRTVPPAIPGIVFLSGIQREEQATLNLNAMNKLDVLKPWTLTFSFGGALQQSAIKAWAGKPENVAKAQAKFLTRCKANKDATLGKY 337          
BLAST of FC931413 vs. ExPASy Swiss-Prot
Match: ALDOB_CHICK (Fructose-bisphosphate aldolase B OS=Gallus gallus GN=ALDOB PE=3 SV=3)

HSP 1 Score: 276.944 bits (707), Expect = 7.164e-74
Identity = 144/218 (66.06%), Postives = 159/218 (72.94%), Query Frame = 1
Query:   10 QGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGPVPIVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAP-KVTPDVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVXVQANSEATLGTY 660
            QGLD LA+RC +Y + GA F KWRAVLKI    PSQLAI ENAN LARYA ICQ+NG VPIVEPE+L DG HD+ +C  VTE+VLAA YKALNDHHV LEGTLLKPNMVT G   P K TP  +A  TV  L RT+PAAVP + FLSGGQSEEEA+ NLNAMNQ    KPW L+FS+GRALQ S L AW GK EN + AQ AF    Q NS A  G Y
Sbjct:  126 QGLDKLAERCAQYKKDGADFGKWRAVLKISSTTPSQLAIQENANTLARYASICQQNGLVPIVEPEVLPDGDHDLQRCQYVTEKVLAAVYKALNDHHVYLEGTLLKPNMVTAGHSCPKKYTPQDVAVATVTTLLRTVPAAVPGICFLSGGQSEEEASLNLNAMNQSPLPKPWKLTFSYGRALQASALAAWLGKSENKKAAQEAFCKRAQINSLACRGQY 343          
BLAST of FC931413 vs. ExPASy Swiss-Prot
Match: ALF1_LAMJA (Fructose-bisphosphate aldolase, muscle type OS=Lampetra japonica PE=2 SV=1)

HSP 1 Score: 276.559 bits (706), Expect = 9.357e-74
Identity = 138/220 (62.73%), Postives = 171/220 (77.73%), Query Frame = 1
Query:    7 TQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGPVPIVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAPKVT-PDVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVXVQANSEATLGTYR 663
            TQGLDGLA+RC +Y + GA FAKWR VLKI PN PS+L+I ENAN LARYA ICQ+NG VPIVEPEIL DG HD+  C  +TE+VLAA YKAL+DHHV LEGTLLKPNMVT G+ AP  T P+ +A  T+ AL+RT+P AVP + FLSGGQSEE+A+ +LNA+N+L   KPW+L+FS+GRALQ S LKAW GK+EN++ AQ   +   + N +A+ G Y+
Sbjct:  125 TQGLDGLAERCAQYKKDGADFAKWRCVLKISPNTPSRLSIVENANVLARYATICQQNGLVPIVEPEILPDGDHDLKTCQYITEKVLAATYKALSDHHVYLEGTLLKPNMVTVGTAAPASTRPEQVAMATLTALRRTVPPAVPGITFLSGGQSEEDASIHLNAINKLHLIKPWALTFSYGRALQASVLKAWGGKKENLKAAQDELMRRAKINGQASKGEYK 344          
BLAST of FC931413 vs. ExPASy Swiss-Prot
Match: ALF_DICDI (Fructose-bisphosphate aldolase OS=Dictyostelium discoideum GN=fba PE=3 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 1.222e-73
Identity = 146/234 (62.39%), Postives = 174/234 (74.36%), Query Frame = 1
Query:    7 TQGLDGLAQRCQKYYEAGARFAKWRAVLKI--GPNEPSQLAINENANGLARYAIICQENGPVPIVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAP-KVTPDVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVXVQANSEATLGTYRVMPSLVKVPQSL 699
            TQGLDGLA+RC+KYYEAGARFAKWRAVLKI    N PSQL+I ENA+ LARYA ICQENG VPIVEPEIL+DG H + + A+VTE+VLAA +KALNDHH+LLEG LLKPNMV  G++ P K T + I + TVR LQRT+P A+  VVFLSGGQ+E EAT NLNAMN L   +PW+LSFS+GRALQ S +  W G+  NV+ A+  +L   + NS A LG Y    S     +SL
Sbjct:  118 TQGLDGLAERCKKYYEAGARFAKWRAVLKIDLAKNCPSQLSITENAHTLARYAAICQENGLVPIVEPEILMDGNHTVEQSAEVTEKVLAAVFKALNDHHILLEGALLKPNMVVNGTDCPIKATSEQIGKFTVRTLQRTVPPALTGVVFLSGGQTEIEATANLNAMNVL-PNRPWALSFSYGRALQASVISTWKGESANVEAARKVYLHRAKCNSLAQLGKYTGEESTGSASESL 350          
The following BLAST results are available for this feature:
BLAST of FC931413 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 58
Match NameE-valueIdentityDescription
ALF_ORYSJ8.742e-10583.56Fructose-bisphosphate aldolase cytoplasmic isozyme... [more]
ALF_MAIZE5.624e-10384.47Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_CICAR3.329e-10181.82Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF2_PEA9.644e-10182.19Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_SPIOL5.820e-10081.74Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF1_PEA1.388e-9377.06Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_ARATH1.066e-8572.02Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALDOB_CHICK7.164e-7466.06Fructose-bisphosphate aldolase B OS=Gallus gallus ... [more]
ALF1_LAMJA9.357e-7462.73Fructose-bisphosphate aldolase, muscle type OS=Lam... [more]
ALF_DICDI1.222e-7362.39Fructose-bisphosphate aldolase OS=Dictyostelium di... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34104H02EF PostHarvP1 Citrus clementina cDNA clone C34104H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931413 ID=FC931413|Name=FC931413|organism=Citrus clementina|type=EST|length=711bp
GACCCCACCCAGGGTCTTGATGGCCTCGCCCAGCGCTGCCAGAAATACTA
TGAAGCTGGTGCTCGTTTTGCCAAATGGCGTGCTGTTCTTAAGATTGGCC
CTAATGAGCCTTCGCAGCTGGCCATCAATGAGAATGCCAATGGCCTGGCC
CGATATGCTATCATCTGCCAGGAGAATGGCCCTGTTCCCATTGTTGAACC
TGAGATCCTTGTTGACGGTCCCCATGACATCAACAAGTGTGCTGATGTGA
CCGAGCGTGTTCTTGCAGCATGCTACAAGGCTCTGAATGACCACCATGTC
CTTCTTGAGGGTACCCTTTTGAAGCCCAACATGGTGACCCCTGGATCTGA
AGCTCCCAAAGTTACACCGGACGTGATCGCTGAACACACTGTCCGGGCCC
TGCAACGCACTATGCCTGCAGCAGTTCCTGCTGTTGTGTTCTTGTCTGGT
GGGCAGAGTGAGGAGGAGGCTACCCGCAACCTTAATGCCATGAACCAGCT
CAAGACGAAGAAGCCATGGTCACTTTCCTTCTCCTTTGGACGTGCACTTC
AGCAGAGCACTCTCAAGGCATGGGCTGGAAAGGAAGAGAATGTGCAGAAG
GCCCAGGCTGCTTTCCTTGTCNAGGTGCAGGCCAACTCTGAGGCTACCCT
CGGTACTTACAGGGTGATGCCCAGCTTGGTGAAGGTGCCGCAGAGTCTCT
CCATGTCAGGA
back to top