FC931414

Overview
NameFC931414
Unique NameFC931414
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length699
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931414 vs. ExPASy Swiss-Prot
Match: RBD2A_ARATH (Ras-related protein RABD2A OS=Arabidopsis thaliana GN=RABD2A PE=1 SV=3)

HSP 1 Score: 200.29 bits (508), Expect = 8.279e-51
Identity = 96/112 (85.71%), Postives = 106/112 (94.64%), Query Frame = 2
Query:    2 DQESFNNVKQWLNEIDRYASDNVNKLLVGNKCDLTANKVVSYETAKAFADEIGIPFMETSAKDSTTVEQAFMAMAASIKDRMASQPSMNNARPPTVQIKGQPVAQKSGCCST 337
            D+ESFNNVKQWL+EIDRYASDNVNKLLVGNK DLT N+ + YETAKAFADEIGIPFMETSAKD+T VEQAFMAM+ASIK+RMASQP+ NNARPPTVQI+GQPVAQK+GCCST
Sbjct:   92 DEESFNNVKQWLSEIDRYASDNVNKLLVGNKSDLTENRAIPYETAKAFADEIGIPFMETSAKDATNVEQAFMAMSASIKERMASQPAGNNARPPTVQIRGQPVAQKNGCCST 203          
BLAST of FC931414 vs. ExPASy Swiss-Prot
Match: YPTM2_MAIZE (GTP-binding protein YPTM2 OS=Zea mays GN=YPTM2 PE=2 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 1.726e-48
Identity = 95/112 (84.82%), Postives = 104/112 (92.86%), Query Frame = 2
Query:    2 DQESFNNVKQWLNEIDRYASDNVNKLLVGNKCDLTANKVVSYETAKAFADEIGIPFMETSAKDSTTVEQAFMAMAASIKDRMASQPSMNNARPPTVQIKGQPVAQKSGCCST 337
            DQESFNNVKQWLNEIDRYASDNVNKLLVGNK DLTANKVV+ ETAKAFADE+GIPFMETSAK++T V+QAFMAMAASIKDRMASQP+  NARP TVQI+GQPV QK+ CCS+
Sbjct:   92 DQESFNNVKQWLNEIDRYASDNVNKLLVGNKSDLTANKVVATETAKAFADEMGIPFMETSAKNATNVQQAFMAMAASIKDRMASQPAAANARPATVQIRGQPVNQKTSCCSS 203          
BLAST of FC931414 vs. ExPASy Swiss-Prot
Match: RIC1_ORYSJ (Ras-related protein RIC1 OS=Oryza sativa subsp. japonica GN=RIC1 PE=2 SV=2)

HSP 1 Score: 181.8 bits (460), Expect = 3.047e-45
Identity = 86/111 (77.48%), Postives = 98/111 (88.29%), Query Frame = 2
Query:    2 DQESFNNVKQWLNEIDRYASDNVNKLLVGNKCDLTANKVVSYETAKAFADEIGIPFMETSAKDSTTVEQAFMAMAASIKDRMASQPSMNNARPPTVQIKGQPVAQKSGCCS 334
            DQESFNNVKQWLNEIDRYAS+NVNKLLVGNKCDL  N+VVSYE  KA ADEIGIPF+ETSAKD+T VE+AFM MA  IK+RMASQP+ N ++P TVQ++GQPVAQ+S CCS
Sbjct:   92 DQESFNNVKQWLNEIDRYASENVNKLLVGNKCDLAENRVVSYEAGKALADEIGIPFLETSAKDATNVEKAFMTMAGEIKNRMASQPATNASKPATVQMRGQPVAQQSSCCS 202          
BLAST of FC931414 vs. ExPASy Swiss-Prot
Match: YPTC1_CHLRE (GTP-binding protein YPTC1 OS=Chlamydomonas reinhardtii GN=YPTC1 PE=3 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 8.038e-38
Identity = 80/111 (72.07%), Postives = 90/111 (81.08%), Query Frame = 2
Query:    2 DQESFNNVKQWLNEIDRYASDNVNKLLVGNKCDLTANKVVSYETAKAFADEIGIPFMETSAKDSTTVEQAFMAMAASIKDRMASQPSMNNARPPTVQ-IKGQPVAQKSGCC 331
            DQESFNNVKQWLNEIDRYAS+NVNKLLVGNK DLT+ KVV Y  AKAFADEIGIPF+ETSAK++T VEQAFM MAA IK+RMASQP    A  P V+  +G+P+  KS  C
Sbjct:   92 DQESFNNVKQWLNEIDRYASENVNKLLVGNKSDLTSKKVVEYSVAKAFADEIGIPFLETSAKNATNVEQAFMTMAAEIKNRMASQPIPTKAGGPVVRPQEGKPINSKSSSC 202          
BLAST of FC931414 vs. ExPASy Swiss-Prot
Match: YPTV1_VOLCA (GTP-binding protein yptV1 OS=Volvox carteri GN=YPTV1 PE=3 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 1.980e-36
Identity = 78/111 (70.27%), Postives = 88/111 (79.28%), Query Frame = 2
Query:    2 DQESFNNVKQWLNEIDRYASDNVNKLLVGNKCDLTANKVVSYETAKAFADEIGIPFMETSAKDSTTVEQAFMAMAASIKDRMASQPSMNNARPPTVQ-IKGQPVAQKSGCC 331
            DQESFNNVKQWL EIDRYAS+NVNKLLVGNK DLT  KVV Y+ AKAFADEIGIPF+ETSAK++T VEQAFM MAA IK+RMASQP       P V+  +G+P+  KS  C
Sbjct:   92 DQESFNNVKQWLAEIDRYASENVNKLLVGNKSDLTGKKVVDYQAAKAFADEIGIPFLETSAKNATNVEQAFMTMAAEIKNRMASQPVPPKPGGPVVRPTEGKPINNKSSSC 202          
BLAST of FC931414 vs. ExPASy Swiss-Prot
Match: RAB1A_RAT (Ras-related protein Rab-1A OS=Rattus norvegicus GN=Rab1A PE=1 SV=3)

HSP 1 Score: 148.673 bits (374), Expect = 2.859e-35
Identity = 73/110 (66.36%), Postives = 82/110 (74.55%), Query Frame = 2
Query:    2 DQESFNNVKQWLNEIDRYASDNVNKLLVGNKCDLTANKVVSYETAKAFADEIGIPFMETSAKDSTTVEQAFMAMAASIKDRMASQPSMNNARPPTVQIKGQPVAQKSGCC 331
            DQESFNNVKQWL EIDRYAS+NVNKLLVGNKCDLT  KVV Y TAK FAD +GIPF+ETSAK++T VEQ+FM MAA IK RM    +   A    V+I+  PV Q  G C
Sbjct:   95 DQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC 204          
BLAST of FC931414 vs. ExPASy Swiss-Prot
Match: RAB1A_MOUSE (Ras-related protein Rab-1A OS=Mus musculus GN=Rab1A PE=1 SV=3)

HSP 1 Score: 148.673 bits (374), Expect = 2.859e-35
Identity = 73/110 (66.36%), Postives = 82/110 (74.55%), Query Frame = 2
Query:    2 DQESFNNVKQWLNEIDRYASDNVNKLLVGNKCDLTANKVVSYETAKAFADEIGIPFMETSAKDSTTVEQAFMAMAASIKDRMASQPSMNNARPPTVQIKGQPVAQKSGCC 331
            DQESFNNVKQWL EIDRYAS+NVNKLLVGNKCDLT  KVV Y TAK FAD +GIPF+ETSAK++T VEQ+FM MAA IK RM    +   A    V+I+  PV Q  G C
Sbjct:   95 DQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC 204          
BLAST of FC931414 vs. ExPASy Swiss-Prot
Match: RAB1A_HUMAN (Ras-related protein Rab-1A OS=Homo sapiens GN=RAB1A PE=1 SV=3)

HSP 1 Score: 148.673 bits (374), Expect = 2.859e-35
Identity = 73/110 (66.36%), Postives = 82/110 (74.55%), Query Frame = 2
Query:    2 DQESFNNVKQWLNEIDRYASDNVNKLLVGNKCDLTANKVVSYETAKAFADEIGIPFMETSAKDSTTVEQAFMAMAASIKDRMASQPSMNNARPPTVQIKGQPVAQKSGCC 331
            DQESFNNVKQWL EIDRYAS+NVNKLLVGNKCDLT  KVV Y TAK FAD +GIPF+ETSAK++T VEQ+FM MAA IK RM    +   A    V+I+  PV Q  G C
Sbjct:   95 DQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC 204          
BLAST of FC931414 vs. ExPASy Swiss-Prot
Match: RAB1A_CANFA (Ras-related protein Rab-1A OS=Canis familiaris GN=RAB1A PE=1 SV=3)

HSP 1 Score: 148.673 bits (374), Expect = 2.859e-35
Identity = 73/110 (66.36%), Postives = 82/110 (74.55%), Query Frame = 2
Query:    2 DQESFNNVKQWLNEIDRYASDNVNKLLVGNKCDLTANKVVSYETAKAFADEIGIPFMETSAKDSTTVEQAFMAMAASIKDRMASQPSMNNARPPTVQIKGQPVAQKSGCC 331
            DQESFNNVKQWL EIDRYAS+NVNKLLVGNKCDLT  KVV Y TAK FAD +GIPF+ETSAK++T VEQ+FM MAA IK RM    +   A    V+I+  PV Q  G C
Sbjct:   95 DQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC 204          
BLAST of FC931414 vs. ExPASy Swiss-Prot
Match: RAB1_DISOM (Ras-related protein ORAB-1 OS=Discopyge ommata PE=2 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 1.419e-34
Identity = 72/110 (65.45%), Postives = 80/110 (72.73%), Query Frame = 2
Query:    2 DQESFNNVKQWLNEIDRYASDNVNKLLVGNKCDLTANKVVSYETAKAFADEIGIPFMETSAKDSTTVEQAFMAMAASIKDRMASQPSMNNARPPTVQIKGQPVAQKSGCC 331
            DQESFNNVKQWL EIDRYAS+NVNKLLVGNKCDLT  KVV Y TAK FAD +GIPF+ETSAK++T VEQAFM MAA IK RM    +   +    V I+  PV    G C
Sbjct:   92 DQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGATSGGSEKSNVNIQSTPVKSSGGGC 201          
The following BLAST results are available for this feature:
BLAST of FC931414 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 161
Match NameE-valueIdentityDescription
RBD2A_ARATH8.279e-5185.71Ras-related protein RABD2A OS=Arabidopsis thaliana... [more]
YPTM2_MAIZE1.726e-4884.82GTP-binding protein YPTM2 OS=Zea mays GN=YPTM2 PE=... [more]
RIC1_ORYSJ3.047e-4577.48Ras-related protein RIC1 OS=Oryza sativa subsp. ja... [more]
YPTC1_CHLRE8.038e-3872.07GTP-binding protein YPTC1 OS=Chlamydomonas reinhar... [more]
YPTV1_VOLCA1.980e-3670.27GTP-binding protein yptV1 OS=Volvox carteri GN=YPT... [more]
RAB1A_RAT2.859e-3566.36Ras-related protein Rab-1A OS=Rattus norvegicus GN... [more]
RAB1A_MOUSE2.859e-3566.36Ras-related protein Rab-1A OS=Mus musculus GN=Rab1... [more]
RAB1A_HUMAN2.859e-3566.36Ras-related protein Rab-1A OS=Homo sapiens GN=RAB1... [more]
RAB1A_CANFA2.859e-3566.36Ras-related protein Rab-1A OS=Canis familiaris GN=... [more]
RAB1_DISOM1.419e-3465.45Ras-related protein ORAB-1 OS=Discopyge ommata PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34104H03EF PostHarvP1 Citrus clementina cDNA clone C34104H03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931414 ID=FC931414|Name=FC931414|organism=Citrus clementina|type=EST|length=699bp
AGACCAAGAGAGCTTCAATAATGTCAAGCAGTGGTTGAATGAAATTGACC
GTTATGCTAGTGATAATGTCAACAAACTTCTGGTTGGAAACAAGTGTGAT
CTCACTGCAAATAAGGTTGTCTCGTACGAAACAGCCAAGGCATTTGCAGA
TGAAATTGGAATACCTTTCATGGAAACTAGTGCAAAAGATTCTACCACCG
TGGAACAGGCATTCATGGCCATGGCTGCTTCAATCAAGGATAGAATGGCA
AGTCAACCATCCATGAACAATGCAAGGCCTCCAACTGTACAGATCAAAGG
GCAGCCTGTTGCACAGAAGAGTGGCTGCTGCTCTACTTAAGTATCATTGT
AATATATCTGTCGTGGGTCTGCTGGACCTAATGGTGTGTAATGCTTTTCA
TCTTTTCAGTTGAAAGCTATGTCATCTGGACCAACCTCATCAAAAATTGT
TCTCCCTTTGTGGTTTACAGGACCAACACTCAGAAGATGATCCCCTTCCA
GTCCCTTTGTGGTTTATGAAAAGGCCTGTACAAAGTAGAAATGCTAATTT
GATGTTAGTATTCTTCTTTCTGTCCTATTCTTTATTGTGAATTGGCCTTA
ATAGCATGTTTGAATACTGTCAATAGCACTACCTTTTGTCCGTTTTGACA
GCGGTTATTGAAGACTTGAACCCATATTTGTTTAATTGTATGCTACATT
back to top