FC931416

Overview
NameFC931416
Unique NameFC931416
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length741
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931416 vs. ExPASy Swiss-Prot
Match: TAD2A_ARATH (Transcriptional adapter ADA2a OS=Arabidopsis thaliana GN=ADA2A PE=1 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 2.845e-76
Identity = 149/252 (59.13%), Postives = 190/252 (75.40%), Query Frame = 1
Query:    4 AEPQSDRSIGEKKLRTSGDERPSMKELSGYNFKRQEFEIEYDNDAEHLLADMEFNKNDTDAERELKLRVLRIYGKRLDERKRRKDFILERNLLFPDPFERNLSPEEREIYQQYKVFMRFHSKEDHEELLKSVIEEHRIVKRIQELQEAQAAGCRTSSEAHRFLEQKRKKEAEENG-QRVKESGQAGPSGKVLQRPNSLKEVEVSPRGVVRGSTSLQPFGNDSYSTIA-----SSLEDWDISGFVGADLLSET 741
            A+ QSDRS+GEKKLR  G++ P + EL GYN KR+EFEIE+DNDAE LLADMEF  +DTDAERE KL+VLRIY KRLDERKRRK+F+LERNLL+PD +E +LS EER+IY+  KVF RF SKE+H+EL+K VIEEH+I++RI++LQEA+ AGCRT+S+A+RF+E+KRKKEAEE+   R+        +GK L+          SPRG+ R   +L PFG+DS   +      S L+ WD+ G +GADLLSET
Sbjct:  246 AKQQSDRSVGEKKLRLPGEKVPLVTELYGYNLKREEFEIEHDNDAEQLLADMEFKDSDTDAEREQKLQVLRIYSKRLDERKRRKEFVLERNLLYPDQYEMSLSAEERKIYKSCKVFARFQSKEEHKELIKKVIEEHQILRRIEDLQEARTAGCRTTSDANRFIEEKRKKEAEESMLLRLNHGAPGSIAGKTLK----------SPRGLPR---NLHPFGSDSLPKVTPPRIYSGLDTWDVDGLLGADLLSET 484          
BLAST of FC931416 vs. ExPASy Swiss-Prot
Match: TADA2_ORYSJ (Transcriptional adapter ADA2 OS=Oryza sativa subsp. japonica GN=ADA2 PE=2 SV=2)

HSP 1 Score: 266.159 bits (679), Expect = 1.367e-70
Identity = 141/244 (57.79%), Postives = 177/244 (72.54%), Query Frame = 1
Query:   19 DRSIGEKKLRTSGDERPSMKELSGYNFKRQEFEIEYDNDAEHLLADMEFNKNDTDAERELKLRVLRIYGKRLDERKRRKDFILERNLLFPDPFERNLSPEEREIYQQYKVFMRFHSKEDHEELLKSVIEEHRIVKRIQELQEAQAAGCRTSSEAHRFLEQKRKKEAEENGQRVKESGQAGPSGKVLQRPNSLKEVEVSPR-GVVRGSTSLQPFGNDSYSTIASS----LEDWDISGFVGADLLS 735
            DRSIG KK R S DE PS+ ELSGYN KR EF+ EYDNDAE  LA+MEF + D++ +RELKLRVLRIY  RLDERKRRK+FILERNLLFP+P E++L+ E++E+Y +YKVFMRF SKE+HE L++SV+EE +I +RIQELQE ++AGCRT +EA   +EQKRKKE E N Q+ KESGQ   + KV+ + N   ++E        +G  SL   G DS  T   +     +DWDI GF GA+LLS
Sbjct:  254 DRSIGVKKPRYSADEGPSLTELSGYNSKRHEFDPEYDNDAEQALAEMEFKETDSETDRELKLRVLRIYLSRLDERKRRKEFILERNLLFPNPLEKDLTNEDKEVYHRYKVFMRFLSKEEHEALVRSVLEERKIRRRIQELQECRSAGCRTLAEAKIHIEQKRKKEHEVNAQKAKESGQLLSNTKVVHKTNRPMKIESDGNLDQKKGGASLDSTGRDSPKTTGHAGTKHWDDWDIVGFPGAELLS 497          
BLAST of FC931416 vs. ExPASy Swiss-Prot
Match: TAD2B_ARATH (Transcriptional adapter ADA2b OS=Arabidopsis thaliana GN=ADA2B PE=1 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 7.039e-59
Identity = 127/242 (52.48%), Postives = 167/242 (69.01%), Query Frame = 1
Query:   19 DRSIGEKKLRTSGDERPSMKELSGYNFKRQEFEIEYDNDAEHLLADMEFNKNDTDAERELKLRVLRIYGKRLDERKRRKDFILERNLLFPDPFERNLSPEEREIYQQYKVFMRFHSKEDHEELLKSVIEEHRIVKRIQELQEAQAAGCRTSSEAHRFLEQKRKKEAEENGQRVKESGQAGP-SGKVLQRPNSLKEVEVSPRGVVRGSTSLQPFGNDSYSTIASSLEDWDISGFVGADLLSET 741
            DRS G KK   S     S+ ELS YN KR+EF+ EYDNDAE LLA+MEF +NDT  E ELKLRVLRIY KRLDERKRRK+FI+ERNLL+P+PFE++LS EE+   ++  VFMRFHSKE+H+ELL++V+ E+R+VKR+++L+EAQ AGCR+++EA R+L +KRK+E EE   R KESGQ G  +G++  RP     V+ S                      +S + D D+ GF  + LLSE+
Sbjct:  210 DRSFGGKK-PVSTSVNNSLVELSNYNQKREEFDPEYDNDAEQLLAEMEFKENDTPEEHELKLRVLRIYSKRLDERKRRKEFIIERNLLYPNPFEKDLSQEEKVQCRRLDVFMRFHSKEEHDELLRNVVSEYRMVKRLKDLKEAQVAGCRSTAEAERYLGRKRKRENEEGMNRGKESGQFGQIAGEMGSRP----PVQAS----------------------SSYVNDLDLIGFTESQLLSES 424          
BLAST of FC931416 vs. ExPASy Swiss-Prot
Match: ADA2_YEAST (Transcriptional adapter 2 OS=Saccharomyces cerevisiae GN=ADA2 PE=1 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.939e-16
Identity = 50/151 (33.11%), Postives = 79/151 (52.32%), Query Frame = 1
Query:   67 PSMKELSGYNFKRQEFEIEYDNDAEHLLADMEFNKNDTDAERELKLRVLRIYGKRLDERKRRKDFILERNLL---FPDPFERNLSPEEREIYQQYKVFMRFHSKEDHEELLKSVIEEHRIVKRIQELQEAQAAGCRTSSEAHRFLEQKRKK 510
            PS  E+ G+   R EFE E++N+AE  + DM F  +D   + ELK  +L IY  RL  R  +K  + E +L+        ++  S E +E+Y + K F R  + +D EE  K ++EE     RIQ+LQE ++ G  T     ++   K+ +
Sbjct:  157 PSCHEVQGFMPGRLEFETEFENEAEGPVKDMVFEPDDQPLDIELKFAILDIYNSRLTTRAEKKRLLFENHLMDYRKLQAIDKKRSKEAKELYNRIKPFARVMTAQDFEEFSKDILEELHCRARIQQLQEWRSNGLTTLEAGLKYERDKQAR 307          
BLAST of FC931416 vs. ExPASy Swiss-Prot
Match: ADA2_SCHPO (Transcriptional adapter 2 OS=Schizosaccharomyces pombe GN=ada2 PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 4.777e-15
Identity = 52/154 (33.77%), Postives = 80/154 (51.95%), Query Frame = 1
Query:   67 PSMKELSGYNFKRQEFEIEYDNDAEHLLADMEFNKNDTDA---ERELKLRVLRIYGKRLDERKRRKDFILERNLLFPDPFERN---LSPEEREIYQQYKVFMRFHSKEDHEELLKSVIEEHRIVKRIQELQEAQAAGCRTSSEAHRFLEQKRKK 510
            P   E+ GY   R EF+ EY N+AE  + DM F+ +  ++   E +LKL +L IY  RL  R  RK  I   NLL     + N   +S EER +  + K F R  +  D+++ + S  E+  + K+I +LQE +  G  T  + H++   K +K
Sbjct:  158 PQCHEIQGYMPGRLEFDQEYMNEAELPIKDMNFDDDLHESAKHEMQLKLTMLNIYNSRLTRRAVRKQTIFNHNLLDYRRLQANEKRMSKEERNLLNKTKAFARLLTGPDYQKFVNSYHEQITLKKQISDLQEWRQMGLTTLEQGHKYERDKTQK 311          
BLAST of FC931416 vs. ExPASy Swiss-Prot
Match: TAD2B_XENLA (Transcriptional adapter 2-beta OS=Xenopus laevis GN=tada2b PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 6.239e-15
Identity = 47/171 (27.49%), Postives = 89/171 (52.05%), Query Frame = 1
Query:   88 GYNFKRQEFEIEYDNDAEHLLADMEFNKNDTDAERELKLRVLRIYGKRLDERKRRKDFILERNLL----------FPDPFERNLSPEEREIYQQYKVFMRFHSKEDHEELLKSVIEEHRIVKRIQELQEAQAAGCRTSSEAHRFLEQKRKKEAEENGQRVKESGQAGPSGK 570
            GY   R ++EIE+D +AE L++ +  N +D D E ELK   + +Y ++L ER+RRK    + NL+             P +R +S EE+E+  + +   +F S ++ E+  +++ +E  +  +I+ELQ  +  G   + E+  +   + K+E  +  + +  S +    GK
Sbjct:  165 GYMPLRDDYEIEFDQEAETLISGLSVNYDDDDVEVELKEAYVDMYVRKLKERQRRKSLARDYNLVPAFLGKDKKEKEKPAKRKISKEEKELRLKLRPLYQFMSNKEIEDCFENMHKERMLRAKIRELQRYRRNGITKTEESAEYEAARHKREKRKENKNIANSKRGREDGK 335          
BLAST of FC931416 vs. ExPASy Swiss-Prot
Match: TAD2A_HUMAN (Transcriptional adapter 2-alpha OS=Homo sapiens GN=TADA2L PE=1 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 1.815e-14
Identity = 48/151 (31.79%), Postives = 81/151 (53.64%), Query Frame = 1
Query:   76 KELSGYNFKRQEFEIEYDNDAEHLLADMEFNKNDTDAERELKLRVLRIYGKRLDERKRRKDFILERNLLFPDPF---ERNLSPEEREIYQQYKVFMRFHSKEDHEELLKSVIEEHRIVKRIQELQEAQAAGCRTSSEAHRFLEQKRKKEAE 519
            ++++GY   R +F  E+DN AE  L D++F ++D+D    LK+ V+ IY  RL ER+RRK  I +  L+    F   ER    E +++Y+  + F R     +H++ ++S   E  + + I+ LQE + AG      A  +   K+ +E E
Sbjct:  163 RDMAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDILHALKMAVVDIYHSRLKERQRRKKIIRDHGLINLRKFQLMERRYPKEVQDLYETMRRFARIVGPVEHDKFIESHALEFELRREIKRLQEYRTAGITNFCSARTYDHLKKTREEE 313          
BLAST of FC931416 vs. ExPASy Swiss-Prot
Match: TAD2A_BOVIN (Transcriptional adapter 2-alpha OS=Bos taurus GN=TADA2L PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.815e-14
Identity = 48/151 (31.79%), Postives = 81/151 (53.64%), Query Frame = 1
Query:   76 KELSGYNFKRQEFEIEYDNDAEHLLADMEFNKNDTDAERELKLRVLRIYGKRLDERKRRKDFILERNLLFPDPF---ERNLSPEEREIYQQYKVFMRFHSKEDHEELLKSVIEEHRIVKRIQELQEAQAAGCRTSSEAHRFLEQKRKKEAE 519
            ++++GY   R +F  E+DN AE  L D++F ++D+D    LK+ V+ IY  RL ER+RRK  I +  L+    F   ER    E +++Y+  + F R     +H++ ++S   E  + + I+ LQE + AG      A  +   K+ +E E
Sbjct:  163 RDMAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDILHALKMAVVDIYHSRLKERQRRKKIIRDHGLINLRKFQLMERRYPKEVQDLYETMRRFARIVGPVEHDKFIESHALEFELRREIKRLQEYRTAGITNFCSARTYDHLKKTREEE 313          
BLAST of FC931416 vs. ExPASy Swiss-Prot
Match: TAD2A_RAT (Transcriptional adapter 2-alpha OS=Rattus norvegicus GN=Tada2l PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.371e-14
Identity = 48/151 (31.79%), Postives = 81/151 (53.64%), Query Frame = 1
Query:   76 KELSGYNFKRQEFEIEYDNDAEHLLADMEFNKNDTDAERELKLRVLRIYGKRLDERKRRKDFILERNLLFPDPF---ERNLSPEEREIYQQYKVFMRFHSKEDHEELLKSVIEEHRIVKRIQELQEAQAAGCRTSSEAHRFLEQKRKKEAE 519
            ++++GY   R +F  E+DN AE  L D++F ++D+D    LK+ V+ IY  RL ER+RRK  I +  L+    F   ER    E +++Y+  + F R     +H++ ++S   E  + + I+ LQE + AG      A  +   K+ +E E
Sbjct:  163 RDMAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDILHALKMAVVDIYHSRLKERQRRKKIIRDHGLVNLRKFRLMERRYPKEVQDLYETMRRFARIVGPVEHDKFIESHALEFELRREIKRLQEYRTAGITNFCSARTYDHLKKTREEE 313          
BLAST of FC931416 vs. ExPASy Swiss-Prot
Match: TAD2A_MOUSE (Transcriptional adapter 2-alpha OS=Mus musculus GN=Tada2l PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.371e-14
Identity = 48/151 (31.79%), Postives = 81/151 (53.64%), Query Frame = 1
Query:   76 KELSGYNFKRQEFEIEYDNDAEHLLADMEFNKNDTDAERELKLRVLRIYGKRLDERKRRKDFILERNLLFPDPF---ERNLSPEEREIYQQYKVFMRFHSKEDHEELLKSVIEEHRIVKRIQELQEAQAAGCRTSSEAHRFLEQKRKKEAE 519
            ++++GY   R +F  E+DN AE  L D++F ++D+D    LK+ V+ IY  RL ER+RRK  I +  L+    F   ER    E +++Y+  + F R     +H++ ++S   E  + + I+ LQE + AG      A  +   K+ +E E
Sbjct:  163 RDMAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDILHALKMAVVDIYHSRLKERQRRKKIIRDHGLVNLRKFRLMERRYPKEVQDLYETMRRFARIVGPVEHDKFIESHALEFELRREIKRLQEYRTAGITNFCSARTYDHLKKTREEE 313          
The following BLAST results are available for this feature:
BLAST of FC931416 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
TAD2A_ARATH2.845e-7659.13Transcriptional adapter ADA2a OS=Arabidopsis thali... [more]
TADA2_ORYSJ1.367e-7057.79Transcriptional adapter ADA2 OS=Oryza sativa subsp... [more]
TAD2B_ARATH7.039e-5952.48Transcriptional adapter ADA2b OS=Arabidopsis thali... [more]
ADA2_YEAST1.939e-1633.11Transcriptional adapter 2 OS=Saccharomyces cerevis... [more]
ADA2_SCHPO4.777e-1533.77Transcriptional adapter 2 OS=Schizosaccharomyces p... [more]
TAD2B_XENLA6.239e-1527.49Transcriptional adapter 2-beta OS=Xenopus laevis G... [more]
TAD2A_HUMAN1.815e-1431.79Transcriptional adapter 2-alpha OS=Homo sapiens GN... [more]
TAD2A_BOVIN1.815e-1431.79Transcriptional adapter 2-alpha OS=Bos taurus GN=T... [more]
TAD2A_RAT2.371e-1431.79Transcriptional adapter 2-alpha OS=Rattus norvegic... [more]
TAD2A_MOUSE2.371e-1431.79Transcriptional adapter 2-alpha OS=Mus musculus GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34104H05EF PostHarvP1 Citrus clementina cDNA clone C34104H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931416 ID=FC931416|Name=FC931416|organism=Citrus clementina|type=EST|length=741bp
CTTGCAGAACCTCAGTCAGACAGGAGCATTGGGGAGAAAAAACTTAGGAC
ATCTGGGGATGAGAGGCCGTCTATGAAGGAGTTGAGTGGCTATAACTTCA
AGAGACAAGAATTTGAGATTGAATACGATAATGATGCAGAGCATTTATTG
GCAGATATGGAATTTAATAAAAATGATACTGATGCTGAGCGTGAATTGAA
GCTGAGAGTACTGCGTATTTACGGAAAAAGGCTTGATGAGAGGAAACGCA
GGAAGGACTTCATACTTGAAAGAAACTTGCTATTCCCTGATCCATTTGAG
AGGAATCTCTCACCCGAAGAGAGGGAAATATATCAGCAATACAAGGTCTT
CATGCGGTTCCACTCAAAAGAAGATCATGAGGAGTTGCTCAAGAGTGTTA
TTGAAGAACATCGGATTGTCAAAAGAATACAAGAACTTCAGGAAGCACAA
GCTGCTGGTTGTCGTACATCCTCTGAGGCACATAGATTTCTAGAACAGAA
GAGGAAGAAGGAAGCTGAGGAAAATGGCCAGAGAGTGAAGGAAAGTGGCC
AGGCTGGTCCAAGTGGTAAAGTGTTGCAGAGGCCAAATAGTCTCAAAGAA
GTTGAGGTCAGCCCTCGTGGAGTTGTGAGGGGTTCCACCAGTTTACAGCC
ATTTGGCAATGATTCATACTCAACTATTGCTAGCTCCCTGGAAGACTGGG
ACATCTCTGGGTTTGTGGGTGCCGATCTACTTTCTGAAACT
back to top