FC931417

Overview
NameFC931417
Unique NameFC931417
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length718
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15273 contig Ccv1_Contig15273:43..760. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AGL9_PETHY (Agamous-like MADS-box protein AGL9 homolog OS=Petunia hybrida GN=FBP2 PE=1 SV=2)

HSP 1 Score: 374.015 bits (959), Expect = 4.376e-103
Identity = 196/234 (83.76%), Postives = 208/234 (88.89%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCGYGLKPAQPQGDTFFHALECEPTLXIGYQPADPISVVTAGPSL 709
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPE N+S REALE+SSQQEYLKLKARYEALQRSQRNLLGE+LGPLNSKELESLERQLDMSLKQIRSTRTQ MLD L +LQ KE  L+EAN+TLKQRLMEG  +N LQ   +A+D GYG +  Q QGD FFH LECEPTL IGYQ  DPI+V  AGPS+
Sbjct:    1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPETNISTREALEISSQQEYLKLKARYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLQDLQRKEHALNEANRTLKQRLMEGSTLN-LQWQQNAQDVGYGRQATQTQGDGFFHPLECEPTLQIGYQ-NDPITVGGAGPSV 232          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MTF1_PEA (MADS-box transcription factor 1 OS=Pisum sativum GN=MTF1 PE=2 SV=1)

HSP 1 Score: 355.525 bits (911), Expect = 1.611e-97
Identity = 187/239 (78.24%), Postives = 207/239 (86.61%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREA--LELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCGYGL-KPAQPQGDTFFHA--LECEPTLXIGYQPADPISVVTAGPSL 709
            MGRGRVELKR+ENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEFCS+SSMLKTLERYQKCNYGAPE NV+++EA  LELSSQQEYLKLKARYE+LQRSQRNL+GE+LGPL+SK+LE+LERQLD SLKQIRSTRTQ+MLD L +LQ KE LL EAN+ L+QR MEGYQ+N+LQLN SAED GYG        GD  F    +ECEPTL IGY   DP SVVTAGPS+
Sbjct:    1 MGRGRVELKRVENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSTSSMLKTLERYQKCNYGAPEGNVTSKEALVLELSSQQEYLKLKARYESLQRSQRNLMGEDLGPLSSKDLETLERQLDSSLKQIRSTRTQFMLDQLGDLQRKEHLLCEANRALRQR-MEGYQINSLQLNLSAEDMGYGRHHQGHTHGDELFQVQPIECEPTLQIGYHQGDPGSVVTAGPSM 238          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: SEP3_ARATH (Developmental protein SEPALLATA 3 OS=Arabidopsis thaliana GN=SEP3 PE=1 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 1.614e-89
Identity = 179/239 (74.90%), Postives = 199/239 (83.26%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREAL--ELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCG-YGLKPAQPQ--GDTFFHALECEPTLXIGYQPADPISVVTAGPSL 709
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSML+TLERYQKCNYGAPEPNV +REAL  ELSSQQEYLKLK RY+ALQR+QRNLLGE+LGPL++KELESLERQLD SLKQIR+ RTQ+MLD L +LQ KE++L+E NKTL+ RL +GYQ+  LQLNP+ E+   YG    Q Q     FF  LECEP L IGYQ       + AGPS+
Sbjct:    1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQRTQRNLLGEDLGPLSTKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKTLRLRLADGYQM-PLQLNPNQEEVDHYGRHHHQQQQHSQAFFQPLECEPILQIGYQGQQ--DGMGAGPSV 236          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AGL9_SINAL (Agamous-like MADS-box protein AGL9 homolog OS=Sinapis alba GN=AGL9 PE=2 SV=1)

HSP 1 Score: 324.324 bits (830), Expect = 3.977e-88
Identity = 176/240 (73.33%), Postives = 198/240 (82.50%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREAL--ELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAED--CGYGLKPAQPQGDT---FFHALECEPTLXIGYQPADPISVVTAGPS 706
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSM++TLERYQKCNYG PEPNV +REAL  ELSSQQEYLKLK RY+ALQR+QRNLLGE+LGPL++KELE LERQLD SLKQIR+ RTQ+MLD L +LQ KE++L+E NKTL+ RL +GYQ+  LQLNP+ ED    YG    Q Q ++   FF  LECEP L +GYQ       + AGPS
Sbjct:    1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMIRTLERYQKCNYGPPEPNVPSREALAVELSSQQEYLKLKERYDALQRTQRNLLGEDLGPLSTKELELLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLNETNKTLRLRLADGYQM-PLQLNPNQEDHHVDYGRHDQQQQQNSHHAFFQPLECEPILQMGYQGQQDHG-MEAGPS 238          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AGL9_SOLLC (Agamous-like MADS-box protein AGL9 homolog OS=Solanum lycopersicum GN=TDR5 PE=2 SV=1)

HSP 1 Score: 319.701 bits (818), Expect = 2.178e-87
Identity = 163/180 (90.56%), Postives = 170/180 (94.44%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVN 547
            MGRGRVELKRIE KINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPN+S REALE+SSQQEYLKLK RYEALQRSQRNLLGE+LGPLNSKELESLERQLDMSLKQIRSTRTQ MLD LT+ Q KE  L+EAN+TLKQRLMEG Q+N
Sbjct:    1 MGRGRVELKRIEGKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALEISSQQEYLKLKGRYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLTDYQRKEHALNEANRTLKQRLMEGSQLN 180          

HSP 2 Score: 24.6386 bits (52), Expect = 2.178e-87
Identity = 12/26 (46.15%), Postives = 15/26 (57.69%), Query Frame = 3
Query:  567 VQKIVVMGLNQLNLRAIPSFTPWNVN 644
            + K+  M   QL LRA+ SF  W VN
Sbjct:  186 MHKLWAMAGKQLKLRAMASFILWIVN 211          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: AGL9_ARADE (Agamous-like MADS-box protein AGL9 homolog OS=Aranda deborah PE=2 SV=1)

HSP 1 Score: 314.694 bits (805), Expect = 3.151e-85
Identity = 168/238 (70.59%), Postives = 188/238 (78.99%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQL-NPS-AEDCGYGLKPAQPQGDTFFHALECEPTLXIGYQPADPISVVTAGPSLKY 715
            MGRGRVELK IENKINRQVTFAKRR  LLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS+SMLKTLE+YQKCN+G+PE  + +RE    SSQQEYLKLK R EALQRSQRNLLGE+LGPL SKELE LERQLD SL+QIRSTRTQ+MLD L +LQ +EQ+L EANKTLK+R  E  Q N  Q+ +PS     GYG +PAQ  G+ F+H LECEPTL IGY     ++  TA     Y
Sbjct:    1 MGRGRVELKMIENKINRQVTFAKRRKRLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSTSMLKTLEKYQKCNFGSPESTIISRET--QSSQQEYLKLKNRVEALQRSQRNLLGEDLGPLGSKELEQLERQLDSSLRQIRSTRTQFMLDQLADLQRREQMLCEANKTLKRRFEESSQANQQQVWDPSNTHAVGYGRQPAQHHGEAFYHPLECEPTLQIGYHSDITMATATASTVNNY 236          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: SEP1_ARATH (Developmental protein SEPALLATA 1 OS=Arabidopsis thaliana GN=SEP1 PE=1 SV=2)

HSP 1 Score: 276.944 bits (707), Expect = 7.281e-74
Identity = 150/225 (66.67%), Postives = 173/225 (76.89%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSA------EDCGYGLKPAQPQGDTFFHALECEPTLXIGY 664
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSS+MLKTL+RYQKC+YG+ E N    + LE +S +EYLKLK RYE LQR QRNLLGE+LGPLNSKELE LERQLD SLKQ+RS +TQYMLD L++LQ+KEQ+L E N+ L  +L +   V +  +          ++  Y    AQ QG   +  LEC PTL +GY
Sbjct:    1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSNMLKTLDRYQKCSYGSIEVNNKPAKELE-NSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQNKEQMLLETNRALAMKLDDMIGVRSHHMGGGGGWEGGEQNVTYAHHQAQSQG--LYQPLECNPTLQMGY 222          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: SEP2_ARATH (Developmental protein SEPALLATA 2 OS=Arabidopsis thaliana GN=SEP2 PE=1 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 3.613e-73
Identity = 148/224 (66.07%), Postives = 172/224 (76.79%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAE-----DCGYGLKPAQPQGDTFFHALECEPTLXIGY 664
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEV+LI+FSNRGKLYEFCS+S+MLKTLERYQKC+YG+ E N    + LE +S +EYLKLK RYE LQR QRNLLGE+LGPLNSKELE LERQLD SLKQ+R  +TQYMLD L++LQ KE +L +AN+ L  +L +   V    +    E     +  YG   A  QG   + +LEC+PTL IGY
Sbjct:    1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCSTSNMLKTLERYQKCSYGSIEVNNKPAKELE-NSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRCIKTQYMLDQLSDLQGKEHILLDANRALSMKLEDMIGVRHHHIGGGWEGGDQQNIAYGHPQAHSQG--LYQSLECDPTLQIGY 221          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MADS7_ORYSJ (MADS-box transcription factor 7 OS=Oryza sativa subsp. japonica GN=MADS7 PE=1 SV=2)

HSP 1 Score: 271.937 bits (694), Expect = 2.342e-72
Identity = 151/231 (65.37%), Postives = 178/231 (77.06%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALEL-SSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQL-NPSAEDCGYGLKPAQPQ----GDTFFHALEC--EPTLXIGYQPAD 676
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS+ SM KTLE+YQKC+Y  PE  V  RE+ +L +S+ EYLKLKAR E LQR+QRNLLGE+L  L  KELESLE+QLD SLK +R+TRT++++D LTELQ KEQ++SEAN+ L+++L E   V   Q+        GY  +P   Q    G+ FFH L+   EPTL IGY PA+
Sbjct:    1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTQSMTKTLEKYQKCSYAGPETAVQNRESEQLKASRNEYLKLKARVENLQRTQRNLLGEDLDSLGIKELESLEKQLDSSLKHVRTTRTKHLVDQLTELQRKEQMVSEANRCLRRKLEESNHVRGQQVWEQGCNLIGYERQPEVQQPLHGGNGFFHPLDAAGEPTLQIGY-PAE 230          
BLAST of FC931417 vs. ExPASy Swiss-Prot
Match: MADS7_ORYSI (MADS-box transcription factor 7 OS=Oryza sativa subsp. indica GN=MADS7 PE=2 SV=2)

HSP 1 Score: 271.937 bits (694), Expect = 2.342e-72
Identity = 151/231 (65.37%), Postives = 178/231 (77.06%), Query Frame = 2
Query:    8 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALEL-SSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQL-NPSAEDCGYGLKPAQPQ----GDTFFHALEC--EPTLXIGYQPAD 676
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS+ SM KTLE+YQKC+Y  PE  V  RE+ +L +S+ EYLKLKAR E LQR+QRNLLGE+L  L  KELESLE+QLD SLK +R+TRT++++D LTELQ KEQ++SEAN+ L+++L E   V   Q+        GY  +P   Q    G+ FFH L+   EPTL IGY PA+
Sbjct:    1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTQSMTKTLEKYQKCSYAGPETAVQNRESEQLKASRNEYLKLKARVENLQRTQRNLLGEDLDSLGIKELESLEKQLDSSLKHVRTTRTKHLVDQLTELQRKEQMVSEANRCLRRKLEESNHVRGQQVWEQGCNLIGYERQPEVQQPLHGGNGFFHPLDAAGEPTLQIGY-PAE 230          
The following BLAST results are available for this feature:
BLAST of FC931417 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 117
Match NameE-valueIdentityDescription
AGL9_PETHY4.376e-10383.76Agamous-like MADS-box protein AGL9 homolog OS=Petu... [more]
MTF1_PEA1.611e-9778.24MADS-box transcription factor 1 OS=Pisum sativum G... [more]
SEP3_ARATH1.614e-8974.90Developmental protein SEPALLATA 3 OS=Arabidopsis t... [more]
AGL9_SINAL3.977e-8873.33Agamous-like MADS-box protein AGL9 homolog OS=Sina... [more]
AGL9_SOLLC2.178e-8790.56Agamous-like MADS-box protein AGL9 homolog OS=Sola... [more]
AGL9_ARADE3.151e-8570.59Agamous-like MADS-box protein AGL9 homolog OS=Aran... [more]
SEP1_ARATH7.281e-7466.67Developmental protein SEPALLATA 1 OS=Arabidopsis t... [more]
SEP2_ARATH3.613e-7366.07Developmental protein SEPALLATA 2 OS=Arabidopsis t... [more]
MADS7_ORYSJ2.342e-7265.37MADS-box transcription factor 7 OS=Oryza sativa su... [more]
MADS7_ORYSI2.342e-7265.37MADS-box transcription factor 7 OS=Oryza sativa su... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34104H06EF PostHarvP1 Citrus clementina cDNA clone C34104H06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931417 ID=FC931417|Name=FC931417|organism=Citrus clementina|type=EST|length=718bp
GGAAGAAATGGGAAGGGGTAGGGTTGAGTTGAAGAGGATAGAGAACAAGA
TCAACAGGCAAGTGACCTTTGCAAAGAGAAGAAATGGCCTATTGAAGAAA
GCTTATGAGCTTTCCGTTCTTTGTGATGCTGAGGTTGCTCTCATCATTTT
CTCCAATAGAGGAAAGCTGTACGAGTTTTGCAGTAGTTCAAGCATGCTCA
AAACGCTTGAGAGGTACCAGAAGTGCAACTATGGAGCACCAGAACCGAAT
GTGTCCGCAAGGGAGGCCCTGGAGCTAAGTAGCCAGCAAGAATATCTGAA
GCTTAAAGCACGATATGAAGCCCTACAGAGATCCCAAAGGAATCTCCTTG
GAGAAGAACTTGGCCCTCTAAACAGCAAAGAGCTTGAGTCACTTGAAAGG
CAGCTTGATATGTCATTGAAGCAGATCAGATCAACAAGAACTCAGTACAT
GCTGGATACCCTTACTGAACTGCAACATAAGGAACAGTTGCTGAGCGAAG
CAAATAAGACCCTCAAACAAAGGTTGATGGAGGGATACCAAGTGAACACA
CTTCAATTGAATCCTAGTGCAGAAGATTGTGGTTATGGGCTTAAACCAGC
TCAACCTCAGGGCGATACCTTCTTTCACGCCTTGGAATGTGAACCCACAT
TGNCAATTGGATACCAGCCTGCGGACCCAATATCGGTTGTCACAGCAGGC
CCGAGTCTGAAATATACA
back to top