FC931419

Overview
NameFC931419
Unique NameFC931419
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length719
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14478 contig Ccv1_Contig14478:1..718. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931419 vs. ExPASy Swiss-Prot
Match: IN21B_ORYSJ (Protein IN2-1 homolog B OS=Oryza sativa subsp. japonica GN=GSTZ5 PE=2 SV=1)

HSP 1 Score: 282.722 bits (722), Expect = 1.327e-75
Identity = 135/209 (64.59%), Postives = 163/209 (77.99%), Query Frame = 2
Query:   89 TTAQENLPPPLDSKAELPPLFDGTPRLYISYSCPFAQRAWITRNYKGLQDKIKLVPLNLRDRPTWYKEKVYPVNKVPALEHNGKVIGESLDLIKYVDSNFEGPSLLPDDPEKRKFADELFSHIDTFTNDVYTSF--KGDPAKQAGPAFDYLEKALDKFDDGPFFLGQFSQVDIAYIPFVERFQIFLSEEFKYDITAGRPKLAAWIEEXN 709
            ++ +E LPP L S +E PPLFDGT RLY++Y CP+AQRAWI RNYKGLQDKIK+V ++L DRP WYKEKVYP NKVP+LEHN +V GESLDL+KY+D+NFEGP+LLPDD EK++FA+EL ++ D F    Y+S   KGD   +A  A D +E AL KF+DGPFFLGQFS VDIAY+PF+ERFQIF S    YDIT GRP L  +IEE N
Sbjct:   10 SSEKEVLPPSLTSSSEPPPLFDGTTRLYVAYHCPYAQRAWIARNYKGLQDKIKIVAIDLADRPAWYKEKVYPENKVPSLEHNNQVKGESLDLVKYIDTNFEGPALLPDDSEKQQFAEELLAYTDAFNKASYSSIVAKGDVCDEAVAALDKIEAALSKFNDGPFFLGQFSLVDIAYVPFIERFQIFFSGIKNYDITKGRPNLQKFIEEVN 218          
BLAST of FC931419 vs. ExPASy Swiss-Prot
Match: IN21B_ORYSI (Protein IN2-1 homolog B OS=Oryza sativa subsp. indica GN=GSTZ5 PE=1 SV=1)

HSP 1 Score: 282.722 bits (722), Expect = 1.327e-75
Identity = 135/209 (64.59%), Postives = 163/209 (77.99%), Query Frame = 2
Query:   89 TTAQENLPPPLDSKAELPPLFDGTPRLYISYSCPFAQRAWITRNYKGLQDKIKLVPLNLRDRPTWYKEKVYPVNKVPALEHNGKVIGESLDLIKYVDSNFEGPSLLPDDPEKRKFADELFSHIDTFTNDVYTSF--KGDPAKQAGPAFDYLEKALDKFDDGPFFLGQFSQVDIAYIPFVERFQIFLSEEFKYDITAGRPKLAAWIEEXN 709
            ++ +E LPP L S +E PPLFDGT RLY++Y CP+AQRAWI RNYKGLQDKIK+V ++L DRP WYKEKVYP NKVP+LEHN +V GESLDL+KY+D+NFEGP+LLPDD EK++FA+EL ++ D F    Y+S   KGD   +A  A D +E AL KF+DGPFFLGQFS VDIAY+PF+ERFQIF S    YDIT GRP L  +IEE N
Sbjct:   10 SSEKEVLPPSLTSSSEPPPLFDGTTRLYVAYHCPYAQRAWIARNYKGLQDKIKIVAIDLADRPAWYKEKVYPENKVPSLEHNNQVKGESLDLVKYIDTNFEGPALLPDDSEKQQFAEELLAYTDAFNKASYSSIVAKGDVCDEAVAALDKIEAALSKFNDGPFFLGQFSLVDIAYVPFIERFQIFFSGIKNYDITKGRPNLQKFIEEVN 218          
BLAST of FC931419 vs. ExPASy Swiss-Prot
Match: IN21A_ORYSJ (Protein IN2-1 homolog A OS=Oryza sativa subsp. japonica GN=Os03g0283200 PE=2 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 4.134e-69
Identity = 127/209 (60.77%), Postives = 158/209 (75.60%), Query Frame = 2
Query:   89 TTAQENLPPPLDSKAELPPLFDGTPRLYISYSCPFAQRAWITRNYKGLQDKIKLVPLNLRDRPTWYKEKVYPVNKVPALEHNGKVIGESLDLIKYVDSNFEGPSLLPDDPEKRKFADELFSHIDTFTNDVYTSF--KGDPAKQAGPAFDYLEKALDKFDDGPFFLGQFSQVDIAYIPFVERFQIFLSEEFKYDITAGRPKLAAWIEEXN 709
            ++ +E LP  L S +E P LFDGT RLYI Y CPFAQRAWI RN+KGLQDKI+LV ++L+D+P WYKEKVY    VP+LEHNGK++GESLDLIKY+DS+FEGP+LLP+DPEKR+FADEL ++ + FT  +Y+    K D + +   A D +E AL KF DGPFFLGQFS VDIAY+  +ER QI+ S   KY+IT GRP L  +IEE N
Sbjct:    9 SSGKEALPAALGSASEPPRLFDGTTRLYICYFCPFAQRAWIIRNFKGLQDKIELVGIDLQDKPAWYKEKVYEQGTVPSLEHNGKIMGESLDLIKYIDSHFEGPALLPEDPEKRQFADELIAYANAFTKALYSPLISKADLSAETVAALDKIEAALSKFGDGPFFLGQFSLVDIAYVTIIERIQIYYSHIRKYEITNGRPNLEKFIEEIN 217          
BLAST of FC931419 vs. ExPASy Swiss-Prot
Match: IN21_MAIZE (Protein IN2-1 OS=Zea mays GN=IN2-1 PE=2 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 3.066e-64
Identity = 117/209 (55.98%), Postives = 152/209 (72.73%), Query Frame = 2
Query:   89 TTAQENLPPPLDSKAELPPLFDGTPRLYISYSCPFAQRAWITRNYKGLQDKIKLVPLNLRDRPTWYKEKVYPVNKVPALEHNGKVIGESLDLIKYVDSNFEGPSLLPDDPEKRKFADELFSHIDTFTNDVYTSFKGDPA--KQAGPAFDYLEKALDKFDDGPFFLGQFSQVDIAYIPFVERFQIFLSEEFKYDITAGRPKLAAWIEEXN 709
            ++ +E+LPP L S ++ PP+FDGT RLYI Y CPFAQRAW+TRN KGLQDK++LV ++L+D+P WYK+KVY    VP+LEH+ +V GESLDLI+Y+DSNF+GP+LLP+D  KR+FADELF+  + FT  +Y+      A   +   A D LE  L KFDDGPFFLGQFS  D+AY+  +ER QI+ S    YDI  GRP L  +I+E N
Sbjct:    9 SSVKESLPPALGSTSQPPPVFDGTTRLYICYFCPFAQRAWVTRNLKGLQDKMELVAIDLQDKPAWYKDKVYAQGTVPSLEHDSEVRGESLDLIRYIDSNFDGPALLPEDAAKRQFADELFASANAFTKALYSPLLSHAAVSDEVVAALDKLEADLSKFDDGPFFLGQFSLADVAYVTILERVQIYYSHLRNYDIAQGRPNLQEFIDEMN 217          
BLAST of FC931419 vs. ExPASy Swiss-Prot
Match: GSTO1_HUMAN (Glutathione S-transferase omega-1 OS=Homo sapiens GN=GSTO1 PE=1 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 1.223e-12
Identity = 57/193 (29.53%), Postives = 94/193 (48.70%), Query Frame = 2
Query:  143 PLFDGTPRLYISYSCPFAQRAWITRNYKGLQDKIKLVPLNLRDRPTWYKEKVYPVNKVPALEHN-GKVIGESLDLIKYVDSNFEGPSLLPDDPEKR---KFADELFSHIDTFTND-VYTSFKGDPA---KQAGPAFDYLEKALDKFDDGPFFLGQFSQVDIAYIPFVERFQIFLSEEFKYDITAGRPKLAAWI 697
            P+ +G+ R+Y    CPFA+R  +    KG++ ++  + +NL+++P W+ +K  P   VP LE++ G++I ES    +Y+D  + G  LLPDDP ++   K   ELFS + +     + +  K D A   ++    F  LE+ L       F     S +D    P+ ER +     E         PKL  W+
Sbjct:   18 PVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEV--ININLKNKPEWFFKK-NPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNE----CVDHTPKLKLWM 203          
BLAST of FC931419 vs. ExPASy Swiss-Prot
Match: GSTO1_MOUSE (Glutathione S-transferase omega-1 OS=Mus musculus GN=Gsto1 PE=2 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 1.597e-12
Identity = 61/196 (31.12%), Postives = 96/196 (48.98%), Query Frame = 2
Query:  143 PLFDGTPRLYISYSCPFAQRAWITRNYKGLQDKIKLVPLNLRDRPTWYKEKVYPVNKVPALEHN-GKVIGESLDLIKYVDSNFEGPSLLPDDPEKR---KFADELFSHIDTFTNDVYTSFKGDPAKQAGPAF-DYLEKALDKFDDG----PFFLG--QFSQVDIAYIPFVERFQIFLSEEFKYDITAGRPKLAAWI 697
            P+ +G  R+Y    CPFAQR  +    KG++ ++  + +NL+++P W+ EK  P+  VP LE++ G ++ ES+   +Y+D  +    L PDDP K+   K   E FS +      +  SF     K+  P   + LE    K ++G      FLG    S VD    P+ +R +     E K +  A  PKL  W+
Sbjct:   18 PVPEGQIRVYSMRFCPFAQRTLMVLKAKGIRHEV--ININLKNKPEWFFEK-NPLGLVPVLENSQGHLVTESVITCEYLDEAYPEKKLFPDDPYKKARQKMTLESFSKVP----PLIASFVRSKRKEDSPNLREALENEFKKLEEGMDNYKSFLGGDSPSMVDYLTWPWFQRLEAL---ELK-ECLAHTPKLKLWM 202          
BLAST of FC931419 vs. ExPASy Swiss-Prot
Match: GSTO1_RAT (Glutathione S-transferase omega-1 OS=Rattus norvegicus GN=Gsto1 PE=1 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 2.085e-12
Identity = 62/197 (31.47%), Postives = 96/197 (48.73%), Query Frame = 2
Query:  143 PLFDGTPRLYISYSCPFAQRAWITRNYKGLQDKIKLVPLNLRDRPTWYKEKVYPVNKVPALEH-NGKVIGESLDLIKYVDSNFEGPSLLPDDPEKR---KFADELFSHIDTFTNDVYTSFKGDPAKQAGPAF-DYLEKALDKFDDG------PFFLG-QFSQVDIAYIPFVERFQIFLSEEFKYDITAGRPKLAAWI 697
            P+ +G  R+Y    CPFAQR  +    KG++ +I  + +NL+++P W+ EK  P   VP LE+  G +I ES+   +Y+D  +    L PDDP ++   K   ELFS + +    + TSF     K+  P   + L+K   K ++        FF G   S +D    P+ +R +     E   D T   PKL  W+
Sbjct:   18 PVPEGQIRVYSMRFCPFAQRTLMVLKAKGIRHEI--ININLKNKPEWFFEK-NPFGLVPVLENTQGHLITESVITCEYLDEAYPEKKLFPDDPYEKACQKMTFELFSKVPS----LVTSFIRAKRKEDHPGIKEELKKEFSKLEEAMANKRTAFFGGNSLSMIDYLIWPWFQRLEALELNEC-IDHT---PKLKLWM 203          
BLAST of FC931419 vs. ExPASy Swiss-Prot
Match: GSTO1_PIG (Glutathione S-transferase omega-1 OS=Sus scrofa GN=GSTO1 PE=1 SV=2)

HSP 1 Score: 72.0182 bits (175), Expect = 3.557e-12
Identity = 59/193 (30.57%), Postives = 92/193 (47.67%), Query Frame = 2
Query:  143 PLFDGTPRLYISYSCPFAQRAWITRNYKGLQDKIKLVPLNLRDRPTWYKEKVYPVNKVPALEHN-GKVIGESLDLIKYVDSNFEGPSLLPDDPEKR---KFADELFSHID----TFTNDVYTSFKGDPAKQAGPAFDYLEKALDKFDDGPFFLGQFSQVDIAYIPFVERFQIFLSEEFKYDITAGRPKLAAWI 697
            P+ +G  R+Y    CPFAQR  +  N KG++ ++  + +NL+++P W+ +K  P   VP LE++ G++I ES    +Y+D  + G  LLPDDP ++   K   EL S +      F      +      ++    F  LE+ L K     F     S +D    P+ ER +     E   D T   PKL  W+
Sbjct:   18 PVPEGLIRVYSMRFCPFAQRTLLVLNAKGIRHQV--ININLKNKPEWFFQK-NPSGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMVFELSSKVPPLLIRFIRRENEADCSGLKEELRKEFSKLEEVLTKKKTTYFGGSSLSMIDYLIWPWFERLEALELNEC-IDHT---PKLKLWM 203          
BLAST of FC931419 vs. ExPASy Swiss-Prot
Match: GSTO1_CAEEL (Glutathione transferase omega-1 OS=Caenorhabditis elegans GN=gsto-1 PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.352e-11
Identity = 62/205 (30.24%), Postives = 94/205 (45.85%), Query Frame = 2
Query:  140 PPLFDGTPRLYISYSCPFAQRAWITRNYKGLQDKIKLVPLNLRDRPTWYKEKVYPVNKVPALEHNGKVIGESLDLIKYVDSNFEGPSLLPDDP----EKRKFADEL--FSHIDTFTNDVYTSFKGDPAKQAGPAFDYLEKALDKFDDGPFFLGQFSQVDIAYIPFVERFQIFLSEEFKYDITA-------GRPKLAAWIEEXNSS 715
            PPL  G+ R+Y    CP+A+RA +    KG++ ++  V LN+ D+  WY  K Y   K PA+EHNGKV+ ES  + +Y+D  F    +LP DP    +++  AD L   +H       V         KQ    F+ L++A +   +  +   Q    D    PF E+     S +   D+           PKL  W ++  SS
Sbjct:   18 PPLSKGSFRVYNMRFCPWAERAMLYVAAKGIEAEV--VNLNVTDKLEWYWTKHYQ-GKAPAVEHNGKVVIESGFIPEYLDDAFPETRILPTDPYEKVQQKLLADRLTAVAHAVPLLFAVMRDRTLKDEKQR-KVFEVLKQAENLLANDFYAGSQPGYPDYLSFPFFEKIWWSASLDGVVDLPTIEFPGEEEYPKLTKWFQKMISS 218          
The following BLAST results are available for this feature:
BLAST of FC931419 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
IN21B_ORYSJ1.327e-7564.59Protein IN2-1 homolog B OS=Oryza sativa subsp. jap... [more]
IN21B_ORYSI1.327e-7564.59Protein IN2-1 homolog B OS=Oryza sativa subsp. ind... [more]
IN21A_ORYSJ4.134e-6960.77Protein IN2-1 homolog A OS=Oryza sativa subsp. jap... [more]
IN21_MAIZE3.066e-6455.98Protein IN2-1 OS=Zea mays GN=IN2-1 PE=2 SV=1[more]
GSTO1_HUMAN1.223e-1229.53Glutathione S-transferase omega-1 OS=Homo sapiens ... [more]
GSTO1_MOUSE1.597e-1231.12Glutathione S-transferase omega-1 OS=Mus musculus ... [more]
GSTO1_RAT2.085e-1231.47Glutathione S-transferase omega-1 OS=Rattus norveg... [more]
GSTO1_PIG3.557e-1230.57Glutathione S-transferase omega-1 OS=Sus scrofa GN... [more]
GSTO1_CAEEL1.352e-1130.24Glutathione transferase omega-1 OS=Caenorhabditis ... [more]
back to top
Properties
Property NameValue
Genbank descriptionC34104H08EF PostHarvP1 Citrus clementina cDNA clone C34104H08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931419 ID=FC931419|Name=FC931419|organism=Citrus clementina|type=EST|length=719bp
GGAACATTTCGGTATCAGGTAACTTTCTTCTTCAAAGCAAAAGAAAAGCT
TTCAGGAAACCTCTAGAGTCTTACCTTCCTCAATGGGAACCACAGCGCAA
GAGAATCTCCCTCCACCGTTGGATTCGAAGGCCGAGCTACCACCTCTGTT
CGATGGAACTCCCAGGTTGTACATTTCTTACTCGTGCCCATTTGCTCAGC
GTGCGTGGATCACCAGGAACTACAAGGGATTACAAGACAAGATTAAGTTA
GTTCCACTGAACCTCCGAGATAGGCCCACTTGGTACAAGGAGAAGGTTTA
TCCTGTTAACAAGGTTCCAGCACTGGAGCACAATGGCAAAGTTATTGGAG
AATCTCTTGATTTGATTAAATATGTTGACAGCAATTTTGAAGGGCCTTCA
CTTTTACCTGATGATCCTGAGAAACGAAAGTTTGCTGATGAACTGTTTTC
CCACATCGATACCTTCACCAACGATGTGTACACTTCATTCAAAGGAGACC
CAGCAAAACAAGCTGGTCCTGCTTTTGATTACTTAGAGAAGGCCCTTGAT
AAATTTGATGATGGCCCGTTCTTCCTTGGACAGTTCAGTCAGGTGGACAT
AGCCTATATTCCATTTGTTGAGAGATTCCAGATCTTCTTATCAGAAGAAT
TTAAGTATGACATCACTGCAGGCAGGCCTAAACTGGCAGCATGGATTGAG
GAGNTGAACAGCTCGATGC
back to top