FC931421

Overview
NameFC931421
Unique NameFC931421
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length722
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931421 vs. ExPASy Swiss-Prot
Match: K6PF7_ARATH (6-phosphofructokinase 7 OS=Arabidopsis thaliana GN=PFK7 PE=1 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 6.712e-62
Identity = 66/84 (78.57%), Postives = 75/84 (89.29%), Query Frame = 1
Query:  187 SNNGNSQRKIVTGPAGYVLEDVPHLSDYIPDLPTYPNPLQDNPAYSVVKQYFVHVDDTVPQKVVVHKDSPRGTHFRRAGPRQKV 438
            S+  +++ KIV GP GY+L+DVPHL DY+PDLPTYPNPLQDNPAYSVVKQYFVH DD+VP+KVVVHKD PRG HFRRAGPRQKV
Sbjct:    2 SSPRSNKPKIVNGPGGYILQDVPHLIDYLPDLPTYPNPLQDNPAYSVVKQYFVHADDSVPEKVVVHKDGPRGVHFRRAGPRQKV 85          

HSP 2 Score: 110.538 bits (275), Expect = 6.712e-62
Identity = 50/56 (89.29%), Postives = 54/56 (96.43%), Query Frame = 2
Query:  518 QVYFESDEVYACIVTCGGLCPGLNTVIREIVYSLYYMYGVKRVLGIDGGYRGFYAK 685
            +VYFESDEV+ACIVTCGGLCPGLNTVIRE+V SL YMYGVKR+LGIDGGYRGFYAK
Sbjct:   84 KVYFESDEVHACIVTCGGLCPGLNTVIREVVSSLSYMYGVKRILGIDGGYRGFYAK 139          
BLAST of FC931421 vs. ExPASy Swiss-Prot
Match: K6PF3_ARATH (6-phosphofructokinase 3 OS=Arabidopsis thaliana GN=PFK3 PE=1 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 1.243e-60
Identity = 65/80 (81.25%), Postives = 71/80 (88.75%), Query Frame = 1
Query:  199 NSQRKIVTGPAGYVLEDVPHLSDYIPDLPTYPNPLQDNPAYSVVKQYFVHVDDTVPQKVVVHKDSPRGTHFRRAGPRQKV 438
            +S+ KI+ G  GYVLEDVPHLSDY+P LPTYPNPLQDNPAYSVVKQYFV  DD+VPQK+VVHKD PRG HFRRAGPRQKV
Sbjct:    6 SSKPKIINGSCGYVLEDVPHLSDYLPGLPTYPNPLQDNPAYSVVKQYFVDADDSVPQKIVVHKDGPRGIHFRRAGPRQKV 85          

HSP 2 Score: 110.923 bits (276), Expect = 1.243e-60
Identity = 51/56 (91.07%), Postives = 54/56 (96.43%), Query Frame = 2
Query:  518 QVYFESDEVYACIVTCGGLCPGLNTVIREIVYSLYYMYGVKRVLGIDGGYRGFYAK 685
            +VYFESDEV+ACIVTCGGLCPGLNTVIREIV SL YMYGVKR+LGIDGGYRGFYAK
Sbjct:   84 KVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKRILGIDGGYRGFYAK 139          
BLAST of FC931421 vs. ExPASy Swiss-Prot
Match: K6PF1_ARATH (6-phosphofructokinase 1 OS=Arabidopsis thaliana GN=PFK1 PE=1 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 4.684e-60
Identity = 69/85 (81.18%), Postives = 74/85 (87.06%), Query Frame = 1
Query:  184 ASNNGNSQRKIVTGPAGYVLEDVPHLSDYIPDLPTYPNPLQDNPAYSVVKQYFVHVDDTVPQKVVVHKDSPRGTHFRRAGPRQKV 438
            +S+  NS RKIVTGPAGY+LEDVPH SD  PD PTYPNPLQDN AYSVVKQYFV  DDTVPQK+VVH DSPRGTHFRRAGPRQ+V
Sbjct:    2 SSSVPNSDRKIVTGPAGYILEDVPHFSDDFPDHPTYPNPLQDNAAYSVVKQYFVDEDDTVPQKIVVHPDSPRGTHFRRAGPRQRV 86          

HSP 2 Score: 105.916 bits (263), Expect = 4.684e-60
Identity = 48/56 (85.71%), Postives = 52/56 (92.86%), Query Frame = 2
Query:  518 QVYFESDEVYACIVTCGGLCPGLNTVIREIVYSLYYMYGVKRVLGIDGGYRGFYAK 685
            +VYFESD+V ACIVTCGGLCPGLNTVIREIV  L YMYGVKR+LGIDGGYRGFYA+
Sbjct:   85 RVYFESDDVLACIVTCGGLCPGLNTVIREIVCGLSYMYGVKRILGIDGGYRGFYAR 140          
BLAST of FC931421 vs. ExPASy Swiss-Prot
Match: K6PF6_ARATH (6-phosphofructokinase 6 OS=Arabidopsis thaliana GN=PFK6 PE=1 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 1.215e-54
Identity = 69/85 (81.18%), Postives = 74/85 (87.06%), Query Frame = 1
Query:  184 ASNNGNSQRKIVTGPAGYVLEDVPHLSDYIPDLPTYPNPLQDNPAYSVVKQYFVHVDDTVPQKVVVHKDSPRGTHFRRAGPRQKV 438
            ASN  + Q K+V GPAGYVLEDVPHLSDYI DLPTYPNPLQ N AYSVV+QYFV  DDTV +K+VVHKDSPRGTHFRRAGPRQKV
Sbjct:    2 ASNGVDEQIKLVEGPAGYVLEDVPHLSDYILDLPTYPNPLQSNAAYSVVRQYFVDEDDTVQEKIVVHKDSPRGTHFRRAGPRQKV 86          

HSP 2 Score: 89.7373 bits (221), Expect = 1.215e-54
Identity = 39/56 (69.64%), Postives = 48/56 (85.71%), Query Frame = 2
Query:  518 QVYFESDEVYACIVTCGGLCPGLNTVIREIVYSLYYMYGVKRVLGIDGGYRGFYAK 685
            +VYF+  +V ACIVTCGGLCPGLNTVIREIV  L++MYGV  V+G+D G+RGFY+K
Sbjct:   85 KVYFKPSDVRACIVTCGGLCPGLNTVIREIVCGLHFMYGVTEVIGVDCGFRGFYSK 140          
BLAST of FC931421 vs. ExPASy Swiss-Prot
Match: K6PF4_ARATH (6-phosphofructokinase 4, chloroplastic OS=Arabidopsis thaliana GN=PFK4 PE=1 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.241e-42
Identity = 42/69 (60.87%), Postives = 57/69 (82.61%), Query Frame = 1
Query:  232 GYVLEDVPHLSDYIPDLPTYPNPLQDNPAYSVVKQYFVHVDDTVPQKVVVHKDSPRGTHFRRAGPRQKV 438
            G+VLEDVPHL+ ++PDLP+YPNPL+++ AY++VK+ FV  +D V Q +VV K S RG HFRRAGPR++V
Sbjct:   68 GFVLEDVPHLTKFLPDLPSYPNPLKESQAYAIVKRTFVSSEDVVAQNIVVQKGSKRGVHFRRAGPRERV 136          

HSP 2 Score: 94.7449 bits (234), Expect = 3.241e-42
Identity = 46/65 (70.77%), Postives = 52/65 (80.00%), Query Frame = 2
Query:  518 QVYFESDEVYACIVTCGGLCPGLNTVIREIVYSLYYMYGVKRVLGIDGGYRGFYAKIHCS-TPRV 709
            +VYF SDEV ACIVTCGGLCPG+NTVIREIV  L  MYGV  +LGI GGYRGFY+K   + TP+V
Sbjct:  135 RVYFRSDEVKACIVTCGGLCPGINTVIREIVCGLNNMYGVNNILGIQGGYRGFYSKNTMNLTPKV 199          
BLAST of FC931421 vs. ExPASy Swiss-Prot
Match: K6PF2_ARATH (6-phosphofructokinase 2 OS=Arabidopsis thaliana GN=PFK2 PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 3.253e-16
Identity = 32/55 (58.18%), Postives = 42/55 (76.36%), Query Frame = 2
Query:  518 QVYFESDEVYACIVTCGGLCPGLNTVIREIVYSLYYMYGVKRVLGIDGGYRGFYA 682
            ++ +E   V A IVTCGGLCPG+NTVIRE+V  L+ +YGV+ + GI  GYRGFY+
Sbjct:   69 EIMYEPSAVKAAIVTCGGLCPGMNTVIRELVVGLWELYGVREIYGIPAGYRGFYS 123          

HSP 2 Score: 29.6462 bits (65), Expect = 3.253e-16
Identity = 16/56 (28.57%), Postives = 29/56 (51.79%), Query Frame = 1
Query:  295 NPLQDNPAYSVVKQYFVHVDDTVPQKVVVHKD--SPRGTHFRRAGPRQKVCVYIPN 456
            NPL+DNP +     +++   D +  +V       S     + RAGPR+++ +Y P+
Sbjct:   21 NPLEDNPYFHPSNGFYITPSDVILAQVAYDHSAHSQSRVAYHRAGPRREI-MYEPS 75          
BLAST of FC931421 vs. ExPASy Swiss-Prot
Match: K6PF5_ARATH (6-phosphofructokinase 5, chloroplastic OS=Arabidopsis thaliana GN=PFK5 PE=1 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 5.186e-12
Identity = 34/56 (60.71%), Postives = 42/56 (75.00%), Query Frame = 2
Query:  518 QVYFESDEVYACIVTCGGLCPGLNTVIREIVYSLYYMYGVKRVLGIDGGYRGFYAK 685
            ++YF  +EV A I+TCGGLCPGLN VIR IV +L  +YGVK ++GI  GYRGF  K
Sbjct:  172 KIYFRPEEVKAAIITCGGLCPGLNDVIRHIVITL-EIYGVKNIVGIPFGYRGFSDK 226          

HSP 2 Score: 20.7866 bits (42), Expect = 5.186e-12
Identity = 20/88 (22.73%), Postives = 34/88 (38.64%), Query Frame = 1
Query:  250 VPHLSDYIPDLPTYPNPL---QDNPAYSVVKQY--------FVHVDDTVPQKVVVHKDSPRGT--------------HFRRAGPRQKV 438
            +PH++D +PD     +       +P    V  Y        +++ +D V  KV+ +  SP                    RAGPR+K+
Sbjct:   87 IPHITDVLPDAEAIRSTFCLKMRSPTEDFVGGYPSDEEWHGYINNNDRVLLKVISY-SSPTSAGAECLDHDCSWVEQWIHRAGPREKI 173          
The following BLAST results are available for this feature:
BLAST of FC931421 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
K6PF7_ARATH6.712e-6278.576-phosphofructokinase 7 OS=Arabidopsis thaliana GN... [more]
K6PF3_ARATH1.243e-6081.256-phosphofructokinase 3 OS=Arabidopsis thaliana GN... [more]
K6PF1_ARATH4.684e-6081.186-phosphofructokinase 1 OS=Arabidopsis thaliana GN... [more]
K6PF6_ARATH1.215e-5481.186-phosphofructokinase 6 OS=Arabidopsis thaliana GN... [more]
K6PF4_ARATH3.241e-4260.876-phosphofructokinase 4, chloroplastic OS=Arabidop... [more]
K6PF2_ARATH3.253e-1658.186-phosphofructokinase 2 OS=Arabidopsis thaliana GN... [more]
K6PF5_ARATH5.186e-1260.716-phosphofructokinase 5, chloroplastic OS=Arabidop... [more]
back to top
Properties
Property NameValue
Genbank descriptionC34104H10EF PostHarvP1 Citrus clementina cDNA clone C34104H10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931421 ID=FC931421|Name=FC931421|organism=Citrus clementina|type=EST|length=722bp
GGAATGGACTCAGTAGCTCTATCATCACCCTCACCATCACCCTCAACTTC
AACTTCTTCTTTGAAATCGCGTTTCCTGCAAAAGCCTTCCCAGAACTCGA
AGCAGTTGTCATCTTCGGTCAGTTTTAGTTCGAGTTCGTGTTCCGATTTT
CGATCTCCGACAAAAGCTATTTCGATGGCGGCGGCATCCAACAATGGAAA
CTCACAGCGAAAGATTGTGACTGGTCCTGCTGGTTATGTTCTTGAAGATG
TTCCTCATTTGTCTGATTATATCCCCGATCTTCCTACATATCCGAATCCG
CTGCAAGACAATCCTGCATATTCTGTTGTTAAGCAATATTTTGTTCATGT
GGATGACACGGTACCACAAAAGGTTGTTGTTCATAAGGATAGTCCAAGAG
GGACTCACTTCCGAAGAGCTGGACCTCGTCAAAAGGTATGTGTTTATATA
CCCAATGTACCAGATTGGAATGGTACCTGCTTATAATTTACATATTCTTT
GGGTGATTGATGTTTCTCAGGTGTATTTTGAGTCAGATGAAGTTTATGCT
TGTATCGTGACATGTGGTGGCTTATGCCCTGGACTCAACACGGTGATTAG
AGAGATAGTTTACAGTCTTTACTACATGTATGGAGTGAAGAGAGTGCTGG
GAATTGATGGAGGATACAGGGGCTTTTATGCTAAAATACATTGCTCTACA
CCTAGGGTGTGATGACATCATA
back to top