FC931422

Overview
NameFC931422
Unique NameFC931422
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length685
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC931422 vs. ExPASy Swiss-Prot
Match: SDR1_ARATH ((+)-neomenthol dehydrogenase OS=Arabidopsis thaliana GN=SDR1 PE=1 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.185e-46
Identity = 100/163 (61.35%), Postives = 127/163 (77.91%), Query Frame = 3
Query:   27 RYAVVTGANKGIGYEVVRQLALNGVITVLTARDEKGGLEAVEKLKHS---GFDNVIFHQLDVADPAAIHSVADFIRSHFGKLDILVNNAGITGISSDADTL-SGFIEEGVARGK-MTQTYESAEKCLQTNYLGAKRMCEALIPLLQLSDSARIVNVSSSLGKL 500
            RYAVVTGAN+GIG+E+ RQLA  G+  VLT+RDE  GLEAVE LK        +++FHQLDVADPA+I S+A+F+++ FGKLDILVNNAGI GI +DA+ L +G  +EG    + +T+TYE  E+C++ NY G KRMCEA IPLL+LSDS RIVNVSSS+G+L
Sbjct:    7 RYAVVTGANRGIGFEICRQLASEGIRVVLTSRDENRGLEAVETLKKELEISDQSLLFHQLDVADPASITSLAEFVKTQFGKLDILVNNAGIGGIITDAEALRAGAGKEGFKWDEIITETYELTEECIKINYYGPKRMCEAFIPLLKLSDSPRIVNVSSSMGQL 169          
BLAST of FC931422 vs. ExPASy Swiss-Prot
Match: SDR2_ARATH (Short-chain dehydrogenase/reductase 2 OS=Arabidopsis thaliana GN=SDR2 PE=1 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 3.448e-46
Identity = 92/163 (56.44%), Postives = 125/163 (76.69%), Query Frame = 3
Query:   27 RYAVVTGANKGIGYEVVRQLALNGVITVLTARDEKGGLEAVEKLKHS---GFDNVIFHQLDVADPAAIHSVADFIRSHFGKLDILVNNAGITGISSDADTL-SGFIEEGVA-RGKMTQTYESAEKCLQTNYLGAKRMCEALIPLLQLSDSARIVNVSSSLGKL 500
            RYA+VTG N+GIG+E+ RQLA  G+  +LT+RDEK GLEAVE LK        +++FHQLDV+DP ++ S+A+F+++HFGKLDIL+NNAG+ G+ +D D L +G  +EG      +T+TYE AE+C++ NY G KRMCEA IPLLQLSDS RI+NVSS +G++
Sbjct:    7 RYAIVTGGNRGIGFEICRQLANKGIRVILTSRDEKQGLEAVETLKKELEISDQSIVFHQLDVSDPVSVTSLAEFVKTHFGKLDILINNAGVGGVITDVDALRAGTGKEGFKWEETITETYELAEECIKINYYGPKRMCEAFIPLLQLSDSPRIINVSSFMGQV 169          
BLAST of FC931422 vs. ExPASy Swiss-Prot
Match: SALR_PAPBR (Salutaridine reductase OS=Papaver bracteatum GN=SALR PE=1 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 1.109e-44
Identity = 97/173 (56.07%), Postives = 120/173 (69.36%), Query Frame = 3
Query:   27 RYAVVTGANKGIGYEVVRQLALNGVITVLTARDEKGGLEAVEKLKHSGFDNVIFHQLDVADP-AAIHSVADFIRSHFGKLDILVNNAGITGISSDADTLSGFI--------------EEGVARGKMTQTYESAEKCLQTNYLGAKRMCEALIPLLQLSDSARIVNVSSSLGKL 500
            R AVVTG NKGIG+E+ +QL+ +G++ VLT RD   GLEAVEKLK+S  +NV+FHQLDV DP   + S+ADFI++ FGKLDILVNNAG+ G S DAD     I              E+  A+  M++TYE AE+CL+ NY G K + E L+PLLQLSDS RIVNVSSS G L
Sbjct:   13 RCAVVTGGNKGIGFEICKQLSSSGIMVVLTCRDVTRGLEAVEKLKNSNHENVVFHQLDVTDPITTMSSLADFIKARFGKLDILVNNAGVAGFSVDADRFKAMISDIGEDSEEVVKIYEKPEAQELMSETYELAEECLKINYYGVKSVTEVLLPLLQLSDSPRIVNVSSSTGSL 185          
BLAST of FC931422 vs. ExPASy Swiss-Prot
Match: MNR1_CAPAN ((+)-neomenthol dehydrogenase OS=Capsicum annuum GN=MNR1 PE=1 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 3.021e-42
Identity = 95/180 (52.78%), Postives = 126/180 (70.00%), Query Frame = 3
Query:   27 RYAVVTGANKGIGYEVVRQLALNGVITVLTARDEKGGLEAVEKLK-HSGF--DNVIFHQLDVADPAAIHSVADFIRSHFGKLDILVNNAGITGISSDADT------LSGFI------EEGVARGKMTQT-------YESAEKCLQTNYLGAKRMCEALIPLLQLSDSARIVNVSSSLGKL 500
            RYAVVTG NKGIGYE  RQLA  GV+ VLT+RDEK G+EA+E+LK  S F  ++++FHQLD+ DPA+I S+ + I++ FG+LDIL+NNAGI+G+  + D       L  +I      +E    G  T++       YE  ++C++TNY GAKRM EA IPLLQLS+S RIVNV+SS+GKL
Sbjct:    9 RYAVVTGGNKGIGYETCRQLASKGVVVVLTSRDEKKGIEAIERLKEESNFTDEHILFHQLDIMDPASISSLVNLIKTKFGRLDILINNAGISGVMVEGDVQVLKEILERYISIVFTEDENGEEGGWTKSGPGSVTNYELTKECIETNYYGAKRMTEAFIPLLQLSNSPRIVNVASSMGKL 188          
BLAST of FC931422 vs. ExPASy Swiss-Prot
Match: CBR1_BOVIN (Carbonyl reductase [NADPH] 1 OS=Bos taurus GN=CBR1 PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 2.940e-21
Identity = 63/153 (41.18%), Postives = 92/153 (60.13%), Query Frame = 3
Query:   33 AVVTGANKGIGYEVVRQLA--LNGVITVLTARDEKGGLEAVEKLKHSGFDNVIFHQLDVADPAAIHSVADFIRSHFGKLDILVNNAGITGISSDADTLSGFIEEGVARGKMTQTYESAEKCLQTNYLGAKRMCEALIPLLQLSDSARIVNVSS 485
            A+VTGANKGIG+ +VR L    +G + VLTARDE  G  AV++L+  G  + +FHQLD+ D  +I ++ DF+R  +G LD+LVNNAGI   ++D                 T  +  AE  ++TN+ G + +C  L+PL++     R+VNVSS
Sbjct:    8 ALVTGANKGIGFVIVRDLCRRFSGDV-VLTARDEARGRAAVQQLQAEGL-SPLFHQLDIDDRQSIRALRDFLRKEYGGLDVLVNNAGIAFKTADT----------------TPFHIQAEVTMKTNFFGTRDVCTELLPLIK--PQGRVVNVSS 140          
BLAST of FC931422 vs. ExPASy Swiss-Prot
Match: CBR1_RAT (Carbonyl reductase [NADPH] 1 OS=Rattus norvegicus GN=Cbr1 PE=1 SV=2)

HSP 1 Score: 98.2117 bits (243), Expect = 4.245e-20
Identity = 62/160 (38.75%), Postives = 93/160 (58.13%), Query Frame = 3
Query:   33 AVVTGANKGIGYEVVRQLALNGV-ITVLTARDEKGGLEAVEKLKHSGFDNVIFHQLDVADPAAIHSVADFIRSHFGKLDILVNNAGITGISSDADTLSGFIEEGVARGKMTQTYESAEKCLQTNYLGAKRMCEALIPLLQLSDSARIVNVSSSLGKLMVK 509
            A+VTGANKGIG+ +VR L    +   VLTARDE  G EAV++L+  G  +  FHQLD+ +P +I ++ DF+   +G L++LVNNAGI     D                 T  +  AE  ++TN+ G + +C+ L+P+++     R+VNVSSS+    +K
Sbjct:    8 ALVTGANKGIGFAIVRDLCRKFLGDVVLTARDESRGHEAVKQLQTEGL-SPRFHQLDIDNPQSIRALRDFLLQEYGGLNVLVNNAGIAFKVVDP----------------TPFHIQAEVTMKTNFFGTQDVCKELLPIIK--PQGRVVNVSSSVSLRALK 148          
BLAST of FC931422 vs. ExPASy Swiss-Prot
Match: CBR1_MOUSE (Carbonyl reductase [NADPH] 1 OS=Mus musculus GN=Cbr1 PE=1 SV=3)

HSP 1 Score: 97.4413 bits (241), Expect = 7.241e-20
Identity = 62/161 (38.51%), Postives = 93/161 (57.76%), Query Frame = 3
Query:   33 AVVTGANKGIGYEVVRQLA--LNGVITVLTARDEKGGLEAVEKLKHSGFDNVIFHQLDVADPAAIHSVADFIRSHFGKLDILVNNAGITGISSDADTLSGFIEEGVARGKMTQTYESAEKCLQTNYLGAKRMCEALIPLLQLSDSARIVNVSSSLGKLMVK 509
            A+VTGANKGIG+ + R L    +G + VL ARDE+ G  AV+KL+  G  +  FHQLD+ +P +I ++ DF+   +G LD+LVNNAGI    +D                 T  +  AE  ++TN+ G + +C+ L+PL++     R+VNVSS +    +K
Sbjct:    8 ALVTGANKGIGFAITRDLCRKFSGDV-VLAARDEERGQTAVQKLQAEGL-SPRFHQLDIDNPQSIRALRDFLLKEYGGLDVLVNNAGIAFKVNDD----------------TPFHIQAEVTMKTNFFGTRDVCKELLPLIK--PQGRVVNVSSMVSLRALK 148          
BLAST of FC931422 vs. ExPASy Swiss-Prot
Match: CBR1_PIG (Carbonyl reductase [NADPH] 1 OS=Sus scrofa GN=CBR1 PE=1 SV=3)

HSP 1 Score: 95.9005 bits (237), Expect = 2.107e-19
Identity = 61/157 (38.85%), Postives = 87/157 (55.41%), Query Frame = 3
Query:   27 RYAVVTGANKGIGYEVVRQLALNGV-ITVLTARDEKGGLEAVEKLKHSGFDNVIFHQLDVADPAAIHSVADFIRSHFGKLDILVNNAGITGISSDADTLSGFIEEGVARGKMTQTYESAEKCLQTNYLGAKRMCEALIPLLQLSDSARIVNVSSSLG 494
            R A+VTGANKGIG+ +VR L        VLTARD   G  AV++L+  G  +  FHQLD+ D  +I ++ DF+R  +G LD+LVNNA I                       T  +  AE  ++TN++G + +C  L+PL++     R+VNVSS+ G
Sbjct:    6 RVALVTGANKGIGFAIVRDLCRQFAGDVVLTARDVARGQAAVKQLQAEGL-SPRFHQLDIIDLQSIRALCDFLRKEYGGLDVLVNNAAI----------------AFQLDNPTPFHIQAELTMKTNFMGTRNVCTELLPLIK--PQGRVVNVSSTEG 143          
BLAST of FC931422 vs. ExPASy Swiss-Prot
Match: CBR1_PONAB (Carbonyl reductase [NADPH] 1 OS=Pongo abelii GN=CBR1 PE=2 SV=3)

HSP 1 Score: 93.5893 bits (231), Expect = 1.046e-18
Identity = 62/160 (38.75%), Postives = 88/160 (55.00%), Query Frame = 3
Query:   33 AVVTGANKGIGYEVVRQLA-LNGVITVLTARDEKGGLEAVEKLKHSGFDNVIFHQLDVADPAAIHSVADFIRSHFGKLDILVNNAGITGISSDADTLSGFIEEGVARGKMTQTYESAEKCLQTNYLGAKRMCEALIPLLQLSDSARIVNVSSSLGKLMVK 509
            A+VTG NKGIG  +VR L  L     VLTARD   G  AV++L+  G  +  FHQLD+ D  +I ++ DF+R  +G LD+LVNNAGI    +D                 T  +  AE  ++TN+ G + +C  L+PL++     R+VNVSS +    +K
Sbjct:    8 ALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVARGQAAVQQLQAEGL-SPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADP----------------TPFHIQAEVTMKTNFFGTRDVCTELLPLIK--PQGRVVNVSSIMSVRALK 148          
BLAST of FC931422 vs. ExPASy Swiss-Prot
Match: CBR1_HUMAN (Carbonyl reductase [NADPH] 1 OS=Homo sapiens GN=CBR1 PE=1 SV=3)

HSP 1 Score: 93.5893 bits (231), Expect = 1.046e-18
Identity = 62/160 (38.75%), Postives = 88/160 (55.00%), Query Frame = 3
Query:   33 AVVTGANKGIGYEVVRQLA-LNGVITVLTARDEKGGLEAVEKLKHSGFDNVIFHQLDVADPAAIHSVADFIRSHFGKLDILVNNAGITGISSDADTLSGFIEEGVARGKMTQTYESAEKCLQTNYLGAKRMCEALIPLLQLSDSARIVNVSSSLGKLMVK 509
            A+VTG NKGIG  +VR L  L     VLTARD   G  AV++L+  G  +  FHQLD+ D  +I ++ DF+R  +G LD+LVNNAGI    +D                 T  +  AE  ++TN+ G + +C  L+PL++     R+VNVSS +    +K
Sbjct:    8 ALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGL-SPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADP----------------TPFHIQAEVTMKTNFFGTRDVCTELLPLIK--PQGRVVNVSSIMSVRALK 148          
The following BLAST results are available for this feature:
BLAST of FC931422 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
SDR1_ARATH1.185e-4661.35(+)-neomenthol dehydrogenase OS=Arabidopsis thalia... [more]
SDR2_ARATH3.448e-4656.44Short-chain dehydrogenase/reductase 2 OS=Arabidops... [more]
SALR_PAPBR1.109e-4456.07Salutaridine reductase OS=Papaver bracteatum GN=SA... [more]
MNR1_CAPAN3.021e-4252.78(+)-neomenthol dehydrogenase OS=Capsicum annuum GN... [more]
CBR1_BOVIN2.940e-2141.18Carbonyl reductase [NADPH] 1 OS=Bos taurus GN=CBR1... [more]
CBR1_RAT4.245e-2038.75Carbonyl reductase [NADPH] 1 OS=Rattus norvegicus ... [more]
CBR1_MOUSE7.241e-2038.51Carbonyl reductase [NADPH] 1 OS=Mus musculus GN=Cb... [more]
CBR1_PIG2.107e-1938.85Carbonyl reductase [NADPH] 1 OS=Sus scrofa GN=CBR1... [more]
CBR1_PONAB1.046e-1838.75Carbonyl reductase [NADPH] 1 OS=Pongo abelii GN=CB... [more]
CBR1_HUMAN1.046e-1838.75Carbonyl reductase [NADPH] 1 OS=Homo sapiens GN=CB... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34104H11EF PostHarvP1 Citrus clementina cDNA clone C34104H11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931422 ID=FC931422|Name=FC931422|organism=Citrus clementina|type=EST|length=685bp
ATCTTGGCACACTATATTCTATATTCAGGTATGCAGTTGTTACAGGAGCA
AATAAGGGAATTGGGTATGAAGTAGTGAGGCAATTGGCTTTAAATGGGGT
CATTACGGTACTAACAGCCAGAGATGAGAAGGGGGGTCTTGAAGCTGTTG
AAAAACTCAAACACTCTGGCTTTGATAATGTGATCTTTCATCAGCTTGAT
GTTGCAGACCCTGCTGCTATTCACTCTGTAGCTGATTTCATTCGAAGTCA
TTTTGGAAAGCTTGATATTTTGGTAAATAATGCAGGGATTACTGGAATCA
GTTCGGATGCTGATACTTTGTCAGGTTTTATTGAGGAAGGTGTTGCAAGA
GGAAAAATGACTCAAACTTATGAGTCAGCTGAAAAGTGCCTGCAAACAAA
CTACTTGGGGGCCAAAAGAATGTGTGAAGCACTCATTCCTCTCCTCCAGT
TATCCGATTCAGCAAGAATTGTTAATGTATCCTCTTCCTTGGGAAAGTTG
ATGGTAAAACAGTTTTACAGCCCTTTATAAAATTGAACTAGTTGACATTC
AGGTAGTAATTAAGCCCAATTTGGCCGCTAAATTTTGCTTCCACTGCATC
TGATATTCCCTTATAATTACCTGTAGATCGATATTGGAGTACTCCTTGTC
TCNAATTTTAATTATGATTAAGTTCATTGGAATCA
back to top