FC931423

Overview
NameFC931423
Unique NameFC931423
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length726
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14162 contig Ccv1_Contig14162:2..727. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931423 vs. ExPASy Swiss-Prot
Match: C82A3_SOYBN (Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.620e-44
Identity = 97/222 (43.69%), Postives = 144/222 (64.86%), Query Frame = 1
Query:   22 TPAIFELLSLLIVYFFWRIIAKSINKREKNTAPEPSGAWPLIGHLPLLNGQEPICKILGALADKYGPIYSLRLGKHPILIVSGWEIVKDCFTTNDRILATRAKIVAGKYMGYDNAIFALAPYGQYWRDIRKIATTELLSSHRLELLKHVRYSEVDTFIKDLYSLCSENAFNPAK---VVISKLIEQLTFNISLKLIAGKRFSAKDYEEQGSEAWRXHRAIKK 678
            T AI  +LSL+ +  F  +  K  N R K+ AP  SGAWP++GHL LLNG +   K+LGALADKYGP+++++LG  P L++S WE+ K+ FTTND  +++R K+VA + M Y+ A   LAPYG YWR++RKI T E LS+ R+E   H+R SEV T IK+L+ + S    N ++   V I + +  LTFN+ ++++ GKR+    + E   +A R  + I++
Sbjct:   12 TIAIASILSLIFLCLF--LYRK--NSRGKD-APVVSGAWPILGHLSLLNGSQTPHKVLGALADKYGPLFTIKLGMKPALVLSNWEMSKELFTTNDLAVSSRPKLVAVEVMSYNQAFVGLAPYGPYWRELRKIVTFEFLSNRRIEQRNHIRVSEVRTSIKELFDIWSNGNKNESRYTLVDIKQWLAYLTFNMVVRMVVGKRYFGVMHVEGKDKAQRFMKNIRE 228          
BLAST of FC931423 vs. ExPASy Swiss-Prot
Match: C82A4_SOYBN (Cytochrome P450 82A4 OS=Glycine max GN=CYP82A4 PE=2 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 4.129e-40
Identity = 85/211 (40.28%), Postives = 133/211 (63.03%), Query Frame = 1
Query:   22 TPAIFELLSLLIVYFFWRIIAKSINKREKNTAPEPSGAWPLIGHLPLLNGQEPICKILGALADKYGPIYSLRLGKHPILIVSGWEIVKDCFTTNDRILATRAKIVAGKYMGYDNAIFALAPYGQYWRDIRKIATTELLSSHRLELLKHVRYSEVDTFIKDLYSL--CSENAFNPAKVVISKLIEQLTFNISLKLIAGKRFSAKDYEEQGSE 648
            T  +  L+ LL ++ +  +  K ++   K  AP   GAWP+ GHLPLL G +   K LGALA+K+GP+++++LG    L+VS WE+ ++CFTTND  ++ R K++  + M Y+NA+  +APYG YWR++RKI  TE+LSS R+E L+ VR SEV   I +LY +    +N  + A V + +   Q  FN+ L+++ GKRF +    ++ +E
Sbjct:   12 TIGVVSLIFLLCLFLYGPL--KKVHGSSKE-APTVGGAWPIFGHLPLLIGSKSPHKALGALAEKHGPLFTIKLGAKKALVVSDWEMARECFTTNDVAVSARPKLLVAELMCYNNAMLLVAPYGPYWRELRKIIVTEILSSSRVEQLQDVRVSEVQNSIVELYDVWRSQKNESDYASVELKQWFAQPIFNMVLRMVVGKRFLSATATDEKAE 219          
BLAST of FC931423 vs. ExPASy Swiss-Prot
Match: C82A1_PEA (Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2)

HSP 1 Score: 161.384 bits (407), Expect = 4.565e-39
Identity = 92/228 (40.35%), Postives = 129/228 (56.58%), Query Frame = 1
Query:   22 TPAIFELLSLLIVYFFWRIIAKSINKREKNTAPEPSGAWPLIGHLPLLNGQEPICKILGALADKYGPIYSLRLGKHPILIVSGWEIVKDCFTTNDRILATRAKIVAGKYMGYDNAIFALAPYGQYWRDIRKIATTELLSSHRLELLKHVRYSEVDTFIKDLYSLCSE---------------------NAFNPAKVVISKLIEQLTFNISLKLIAGKR-FSAKDYEEQ 639
            T A   L+SLL  +F +R    S  K      P  SG+WPL+GHLPL+   +   K LGAL DKYGPI++++LG    L++S WE+ K+CFT ND ++++R K VA + M Y+ A    APYG YWR +RKI T E+LS+ R+ELL H+R SEV T IK+L ++ S                      +  +   V + K   QLT N+ L+++ GKR F   D E +
Sbjct:   10 TIAFISLISLL--FFLFRFSKVSHTKEP----PIISGSWPLLGHLPLMRNTQTPHKTLGALVDKYGPIFTIKLGATNALVLSNWELAKECFTKNDIVVSSRPKPVAVELMSYNQAFIGWAPYGAYWRQLRKIVTLEILSNRRIELLSHIRVSEVQTSIKELVNVWSNQISSQYGLLDDTKSSSTNDEPSTTDYVSVELKKWFAQLTLNMVLRMVVGKRCFGDVDVENK 231          
BLAST of FC931423 vs. ExPASy Swiss-Prot
Match: C82A2_SOYBN (Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 2.345e-35
Identity = 82/216 (37.96%), Postives = 128/216 (59.26%), Query Frame = 1
Query:    4 MDSTSFTPAIFELLSLLIVYFFWRIIAKSINKREKNTAPEPSGAWPLIGHLPLLNGQEPICKILGALADKYGPIYSLRLGKHPILIVSGWEIVKDCFTTNDRILATRAKIVAGKYMGYDNAIFALAPYGQYWRDIRKIATTELLSSHRLELLKHVRYSEVDTFIKDLYSLCSEN---AFNPAKVVISKLIEQLTFNISLKLIAGKR-FSAKDYEEQ 639
            ++ST+    +  L+  L++Y F R       K  +   P  +GAWP+IGHLPLL G +   K LG LADKYGPI+S+++G    ++VS WE+ K+C+TTND  +++   +++   + Y+ ++  +APYG YWR +RKI  +E LS  R+E L HVR SEV + I +L+     N       A V + +    L FN+ L+++ GKR FSA   +++
Sbjct:    5 LNSTTIGVGVVSLI--LLLYLFLR---GGSWKSGEEGPPTVAGAWPIIGHLPLLLGSKTPHKTLGDLADKYGPIFSIKIGAKNAVVVSNWEMAKECYTTNDIAVSSLPDLISANLLCYNRSMIVVAPYGPYWRQLRKILMSEFLSPSRVEQLHHVRVSEVQSSITELFRDWRSNKNVQSGFATVELKQWFSLLVFNMILRMVCGKRYFSASTSDDE 215          
BLAST of FC931423 vs. ExPASy Swiss-Prot
Match: C81D1_ARATH (Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CYP81D1 PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 6.838e-27
Identity = 72/229 (31.44%), Postives = 124/229 (54.15%), Query Frame = 1
Query:    4 MDSTSFTPAIFELLSLLIVYFFWRIIAKSINKREKNTAPEPSGAWPLIGHLPLLNGQEPICKILGALADKY-----GPIYSLRLGKHPILIVSGWEIV-KDCFTTNDRILATRAKIVAGKYMGYDNAIFALAPYGQYWRDIRKIATTELLSSHRLELLKHVRYSEVDTFIKDLYSLCSENAFNPAKVVISKLIEQLTFNISLKLIAGKRFSAKDYEEQGSEAWRXHRAI 672
            M+ T+    ++ + SL+    F  I  K +  +++N  P P G  P+IGHL LL  + PI + L + ++       G + SLRLG   + +VS  ++  ++CF  ND +LA R +++ GK++GY+N     APYG +WR++R++ T E+ S+HRL    +VR  EV   I  L  L          V +  ++  LTFN  ++++ GKR+  ++  ++  EA R  + +
Sbjct:    1 MEETNIRVVLYSIFSLI----FLIISFKFLKPKKQNLPPSPPGWLPIIGHLRLL--KPPIHRTLRSFSETLDHNDGGGVMSLRLGSRLVYVVSSHKVAAEECFGKNDVVLANRPQVIIGKHVGYNNTNMIAAPYGDHWRNLRRLCTIEIFSTHRLNCFLYVRTDEVRRLISRLSRLAGT---KKTVVELKPMLMDLTFNNIMRMMTGKRYYGEETTDE-EEAKRVRKLV 219          
BLAST of FC931423 vs. ExPASy Swiss-Prot
Match: C81F1_ARATH (Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2)

HSP 1 Score: 114.775 bits (286), Expect = 4.900e-25
Identity = 62/201 (30.85%), Postives = 115/201 (57.21%), Query Frame = 1
Query:   34 FELLSLLIVYFFWRIIAKSINKREKNTAPEPSGAWPLIGHLPLLNGQEPICKILGALADKYGPIYSLRLGKHPILIVSGWEIVKDCFT-TNDRILATRAKIVAGKYMGYDNAIFALAPYGQYWRDIRKIATTELLSSHRLELLKHVRYSEVDTFIKDL--YSLCSENAFNPAKVVISKLIEQLTFNISLKLIAGKRFSAKD 627
            F LL LL +   ++ +    +K ++   P    + P +GHL L+  + PI ++L   +++YGPI+SLR G   +++++   + ++ FT  ND +L++R   +  KY+ Y++     APYG +WR++R+I + E+LSSHRL   +H+R  E+   +  L  Y+  S  + +   + +  L+  LTFN  ++++ GKR+   D
Sbjct:    4 FILLPLLFLVISYKFL---YSKTQRFNLPPGPPSRPFVGHLHLM--KPPIHRLLQRYSNQYGPIFSLRFGSRRVVVITSPSLAQESFTGQNDIVLSSRPLQLTAKYVAYNHTTVGTAPYGDHWRNLRRICSQEILSSHRLINFQHIRKDEILRMLTRLSRYTQTSNESNDFTHIELEPLLSDLTFNNIVRMVTGKRYYGDD 199          
BLAST of FC931423 vs. ExPASy Swiss-Prot
Match: C75A1_PINTA (Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 6.400e-25
Identity = 75/206 (36.41%), Postives = 106/206 (51.46%), Query Frame = 1
Query:   25 PAIFELLSLLIVYFFWRIIAKSINKREKNTAPEPSGAWPLIGHLPLLNGQEPICKILGALADKYGPIYSLRLGKHPILIVSGWEIVKDCFTTNDRILATRAKIVAGKYMGYDNAIFALAPYGQYWRDIRKIATTELLSSHRLELLKHVRYSEVDTFIKDLYSLCSENAFNPAKVVISKLIEQLTFNISLKLIAGKRFSAKDYEEQG 642
            PAI  L++  I +F   I+ +S         P P   WP+IG+   +  + P+ + L  LA+KYGPI  LR G  P ++VS  E  K    T+D I A+R     GKY  Y+    A +PYG +WR +RKI   ELL+S R+E  KHVR  E+   I   +S+  E+      V +SK I     NI  +++A K+FS  D    G
Sbjct:   17 PAI--LIATFIFFFSCWILHQSQRNERLPPGPYP---WPIIGNFHQV--RLPLHRTLKNLAEKYGPILFLRFGSVPTVVVSSSEKAKHFLKTHDLIFASRPPTSVGKYFFYNFKDIAFSPYGDHWRKMRKICVLELLTSKRIESFKHVRQEELSAMI---HSIWEESESGRIAVNVSKAISTSLANILWRILARKKFSDNDLGADG 212          
BLAST of FC931423 vs. ExPASy Swiss-Prot
Match: C81E1_GLYEC (Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2)

HSP 1 Score: 111.694 bits (278), Expect = 4.148e-24
Identity = 63/204 (30.88%), Postives = 115/204 (56.37%), Query Frame = 1
Query:   37 ELLSLL-------IVYFFWRIIAKSINKREKNTAPEPSGAWPLIGHLPLLNGQEPICKILGALADKYGPIYSLRLGKHPILIVSGWEIVKDCFTTNDRILATRAKIVAGKYMGYDNAIFALAPYGQYWRDIRKIATTELLSSHRLELLKHVRYSEVDTFIKDLYSLCSENAFNPAKVVISKLIEQLTFNISLKLIAGKRFSAKD 627
            E+LSLL        ++F + I+ ++  ++ KN  P P    P+IG+L  L  + P+ +    L++KYG ++SL  G   +++VS     + CFT ND +LA R + ++GKY+ Y+        YG++WR++R+I   ++LS+HR+     +R  E    I     L  +++ N A++ +S  +  +TFN  +++I+GKR+  +D
Sbjct:    2 EILSLLSYSVFYLALFFIFNIVIRA--RKFKNLPPGPPSL-PIIGNLHHL--KRPLHRTFKGLSEKYGHVFSLWFGSRLVVVVSSASEFQQCFTKNDVVLANRPRFLSGKYIFYNYTTLGSTSYGEHWRNLRRITALDVLSNHRINSFSGIRRDETQRLIT---RLADDSSTNFAEMELSSRLYDMTFNNIMRMISGKRYYGED 197          
BLAST of FC931423 vs. ExPASy Swiss-Prot
Match: C71B2_ARATH (Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CYP71B2 PE=2 SV=2)

HSP 1 Score: 103.99 bits (258), Expect = 8.650e-22
Identity = 65/202 (32.18%), Postives = 104/202 (51.49%), Query Frame = 1
Query:   43 LSLLIVYFFWRI--IAKSI----NKREKNTAPEPSGAWPLIGHLPLLNGQEPICKILGALADKYGPIYSLRLGKHPILIVSGWEIVKDCFTTNDRILATRAKIVAGKYMGYDNAIFALAPYGQYWRDIRKIATTELLSSHRLELLKHVRYSEVDTFIKDLYSLCSENAFNPAKVVISKLIEQLTFNISLKLIAGKRFSAKDY 630
            +++L+ +F   +  I  SI    NK  K   P    + P+IG+L  L G    C     L+ KYGP+  LRLG  P++++S  E  +    TND    +R K V    + Y       APYG+YWR++RK+A  EL SS +++  +++R  EVD  +K +    SE+A   + V +SK    LT +I  ++  G+ F+   +
Sbjct:    1 MTILLCFFLVSLLTIVSSIFLKQNKTSKFNLPPSPSSLPIIGNLHHLAGLPHRC--FHKLSIKYGPLVFLRLGSVPVVVISSSEAAEAVLKTNDLECCSRPKTVGSGKLSYGFKDITFAPYGEYWREVRKLAVIELFSSKKVQSFRYIREEEVDFVVKKV----SESALKQSPVDLSKTFFSLTASIICRVALGQNFNESGF 196          
BLAST of FC931423 vs. ExPASy Swiss-Prot
Match: C71DA_SOYBN (Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 5.607e-21
Identity = 64/210 (30.48%), Postives = 117/210 (55.71%), Query Frame = 1
Query:    4 MDSTSFTP-AIFELLSLLIVYF-FWRIIAKSINKREKNTAPEPSG--AWPLIGHLPLLNGQEPICKILGALADKYGPIYSLRLGKHPILIVSGWEIVKDCFTTNDRILATRAKIVAGKYMGYDNAIFALAPYGQYWRDIRKIATTELLSSHRLELLKHVRYSEVDTFIKDLYSLCSE---NAFNPAKVVISKLIEQLTFNISLKLIAGKR 612
            M+  + TP +I+ + S+L ++F F++++ +S +K   +T   P G    PLIG++  + G  P+   L  LADKYGP+  L+LG+   +IV+  E+ ++   T+D   + R   V  + + Y+ +    + +G YWR +RKI T ELL++ R++  + +R  EV   +K + +  SE   + FN     +++ I  +TF I+ +   GK+
Sbjct:    3 MELHNHTPFSIYFITSILFIFFVFFKLVQRSDSKTS-STCKLPPGPRTLPLIGNIHQIVGSLPVHYYLKNLADKYGPLMHLKLGEVSNIIVTSPEMAQEIMKTHDLNFSDRPDFVLSRIVSYNGSGIVFSQHGDYWRQLRKICTVELLTAKRVQSFRSIREEEVAELVKKIAATASEEGGSIFN-----LTQSIYSMTFGIAARAAFGKK 206          
The following BLAST results are available for this feature:
BLAST of FC931423 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 96
Match NameE-valueIdentityDescription
C82A3_SOYBN1.620e-4443.69Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=... [more]
C82A4_SOYBN4.129e-4040.28Cytochrome P450 82A4 OS=Glycine max GN=CYP82A4 PE=... [more]
C82A1_PEA4.565e-3940.35Cytochrome P450 82A1 (Fragment) OS=Pisum sativum G... [more]
C82A2_SOYBN2.345e-3537.96Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=... [more]
C81D1_ARATH6.838e-2731.44Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CY... [more]
C81F1_ARATH4.900e-2530.85Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CY... [more]
C75A1_PINTA6.400e-2536.41Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 P... [more]
C81E1_GLYEC4.148e-2430.88Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata ... [more]
C71B2_ARATH8.650e-2232.18Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CY... [more]
C71DA_SOYBN5.607e-2130.48Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34104H12EF PostHarvP1 Citrus clementina cDNA clone C34104H12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931423 ID=FC931423|Name=FC931423|organism=Citrus clementina|type=EST|length=726bp
GGGATGGATTCTACTTCTTTCACCCCAGCAATTTTTGAGCTCTTATCTCT
GCTAATTGTCTATTTTTTTTGGAGAATCATAGCAAAATCTATAAACAAAA
GAGAGAAAAATACTGCCCCCGAGCCATCTGGGGCATGGCCACTCATCGGC
CATTTGCCTCTGCTAAATGGCCAAGAACCAATTTGCAAAATACTTGGAGC
ATTGGCCGATAAATATGGGCCCATCTATTCTCTTAGACTTGGCAAGCATC
CCATATTGATTGTGAGCGGTTGGGAAATTGTGAAGGATTGCTTCACTACC
AATGACAGAATTCTGGCTACAAGGGCAAAAATTGTAGCAGGCAAGTATAT
GGGTTATGACAACGCCATTTTTGCACTTGCTCCCTACGGTCAGTACTGGC
GTGATATTCGCAAAATAGCCACCACAGAGCTTCTCTCAAGTCACCGGCTT
GAATTGCTGAAGCACGTTCGCTACTCTGAAGTTGACACTTTCATCAAAGA
TTTGTACTCACTTTGCTCAGAAAACGCATTCAATCCTGCGAAGGTGGTGA
TCAGCAAGTTAATCGAGCAGTTAACTTTCAATATAAGCCTGAAACTGATA
GCTGGGAAGCGATTTTCAGCTAAAGATTATGAGGAACAAGGCAGCGAGGC
TTGGCGTATNCATAGAGCAATAAAGAAGCACGCACCTATTCGGGTTTTCG
TCTGGGAGATGCCATACATGGCTTGA
back to top