FC931426

Overview
NameFC931426
Unique NameFC931426
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length714
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig11093 contig Ccv1_Contig11093:721..1434. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931426 vs. ExPASy Swiss-Prot
Match: YOU1_CAEEL (Putative transporter ZK637.1 OS=Caenorhabditis elegans GN=ZK637.1 PE=3 SV=5)

HSP 1 Score: 82.8037 bits (203), Expect = 1.999e-15
Identity = 44/107 (41.12%), Postives = 62/107 (57.94%), Query Frame = 1
Query:   25 YVNVFITSLAELPGLLLSAVIVDRVGRKISMAIMSXXXXXXXXXXXXHQPVTLTTVLLFGARMFANGTFAVACVYAPEVYPTSLRATGAGIASAVGRIGGMVCPLVS 345
            Y ++  T+LAE PGL+++ +I++  GRK +MA+                     TVL+F AR F +G F  A VY PEVYPT+LRA G G  SA+ RIG +V P ++
Sbjct:  372 YFDLLSTTLAEFPGLIITVLIIEWFGRKKTMALEYAVFAIFTFLLYFCLDRFTVTVLIFVARAFISGAFQCAYVYTPEVYPTTLRAVGLGTCSAMARIGAIVTPFIA 478          
BLAST of FC931426 vs. ExPASy Swiss-Prot
Match: SVOP_XENLA (Synaptic vesicle 2-related protein OS=Xenopus laevis GN=svop PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.999e-15
Identity = 44/107 (41.12%), Postives = 61/107 (57.01%), Query Frame = 1
Query:   25 YVNVFITSLAELPGLLLSAVIVDRVGRKISMAIMSXXXXXXXXXXXXHQPVTLTTVLLFGARMFANGTFAVACVYAPEVYPTSLRATGAGIASAVGRIGGMVCPLVS 345
            Y ++  T+L+E PGLL++  I+DRVGRK +MAI                   + TV LF AR F +G F  A VY PEVYPT+ RA G G  S + R+G ++ P ++
Sbjct:  373 YTDLLWTTLSEFPGLLVTLWIIDRVGRKKTMAICFIIFSFSALLLFLCVGRNVLTVFLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIA 479          
BLAST of FC931426 vs. ExPASy Swiss-Prot
Match: SVOP_BOVIN (Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 7.596e-15
Identity = 41/107 (38.32%), Postives = 63/107 (58.88%), Query Frame = 1
Query:   25 YVNVFITSLAELPGLLLSAVIVDRVGRKISMAIMSXXXXXXXXXXXXHQPVTLTTVLLFGARMFANGTFAVACVYAPEVYPTSLRATGAGIASAVGRIGGMVCPLVS 345
            Y+++  T+L+E PG+L++  I+DR+GRK +MA+                   + T+LLF AR F +G F  A VY PEVYPT+ RA G G  S + R+G ++ P ++
Sbjct:  373 YMDLLWTTLSEFPGVLVTLWIIDRLGRKKTMALCFVVFSFCSLLLFICVGRNMLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIA 479          
BLAST of FC931426 vs. ExPASy Swiss-Prot
Match: SVOP_PONAB (Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 9.921e-15
Identity = 41/107 (38.32%), Postives = 63/107 (58.88%), Query Frame = 1
Query:   25 YVNVFITSLAELPGLLLSAVIVDRVGRKISMAIMSXXXXXXXXXXXXHQPVTLTTVLLFGARMFANGTFAVACVYAPEVYPTSLRATGAGIASAVGRIGGMVCPLVS 345
            Y+++  T+L+E PG+L++  I+DR+GRK +MA+                   + T+LLF AR F +G F  A VY PEVYPT+ RA G G  S + R+G ++ P ++
Sbjct:  373 YMDLLWTTLSEFPGVLVTLWIIDRLGRKKTMALCFVIFSFCSLLLFICVGRNVLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIA 479          
BLAST of FC931426 vs. ExPASy Swiss-Prot
Match: SVOP_HUMAN (Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 9.921e-15
Identity = 41/107 (38.32%), Postives = 63/107 (58.88%), Query Frame = 1
Query:   25 YVNVFITSLAELPGLLLSAVIVDRVGRKISMAIMSXXXXXXXXXXXXHQPVTLTTVLLFGARMFANGTFAVACVYAPEVYPTSLRATGAGIASAVGRIGGMVCPLVS 345
            Y+++  T+L+E PG+L++  I+DR+GRK +MA+                   + T+LLF AR F +G F  A VY PEVYPT+ RA G G  S + R+G ++ P ++
Sbjct:  373 YMDLLWTTLSEFPGVLVTLWIIDRLGRKKTMALCFVIFSFCSLLLFICVGRNVLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIA 479          
BLAST of FC931426 vs. ExPASy Swiss-Prot
Match: SVOP_RAT (Synaptic vesicle 2-related protein OS=Rattus norvegicus GN=Svop PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.692e-14
Identity = 40/107 (37.38%), Postives = 63/107 (58.88%), Query Frame = 1
Query:   25 YVNVFITSLAELPGLLLSAVIVDRVGRKISMAIMSXXXXXXXXXXXXHQPVTLTTVLLFGARMFANGTFAVACVYAPEVYPTSLRATGAGIASAVGRIGGMVCPLVS 345
            Y+++  T+L+E PG+L++  ++DR+GRK +MA+                   + T+LLF AR F +G F  A VY PEVYPT+ RA G G  S + R+G ++ P ++
Sbjct:  373 YMDLLWTTLSEFPGVLVTLWVIDRLGRKKTMALCFVIFSLCSLLLFICIGRNVLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIA 479          
BLAST of FC931426 vs. ExPASy Swiss-Prot
Match: SVOP_MOUSE (Synaptic vesicle 2-related protein OS=Mus musculus GN=Svop PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.692e-14
Identity = 40/107 (37.38%), Postives = 63/107 (58.88%), Query Frame = 1
Query:   25 YVNVFITSLAELPGLLLSAVIVDRVGRKISMAIMSXXXXXXXXXXXXHQPVTLTTVLLFGARMFANGTFAVACVYAPEVYPTSLRATGAGIASAVGRIGGMVCPLVS 345
            Y+++  T+L+E PG+L++  ++DR+GRK +MA+                   + T+LLF AR F +G F  A VY PEVYPT+ RA G G  S + R+G ++ P ++
Sbjct:  373 YMDLLWTTLSEFPGVLVTLWVIDRLGRKKTMALCFIIFSLCSLLLFICIGRNVLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIA 479          
The following BLAST results are available for this feature:
BLAST of FC931426 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
YOU1_CAEEL1.999e-1541.12Putative transporter ZK637.1 OS=Caenorhabditis ele... [more]
SVOP_XENLA1.999e-1541.12Synaptic vesicle 2-related protein OS=Xenopus laev... [more]
SVOP_BOVIN7.596e-1538.32Synaptic vesicle 2-related protein OS=Bos taurus G... [more]
SVOP_PONAB9.921e-1538.32Synaptic vesicle 2-related protein OS=Pongo abelii... [more]
SVOP_HUMAN9.921e-1538.32Synaptic vesicle 2-related protein OS=Homo sapiens... [more]
SVOP_RAT1.692e-1437.38Synaptic vesicle 2-related protein OS=Rattus norve... [more]
SVOP_MOUSE1.692e-1437.38Synaptic vesicle 2-related protein OS=Mus musculus... [more]
back to top
Properties
Property NameValue
Genbank descriptionC34105A03EF PostHarvP1 Citrus clementina cDNA clone C34105A03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931426 ID=FC931426|Name=FC931426|organism=Citrus clementina|type=EST|length=714bp
GAACATGCCCAGGATGCCAGCCTATACGTTAATGTATTTATCACTAGCTT
GGCAGAACTTCCCGGGCTTCTGTTATCAGCAGTGATTGTGGACAGAGTTG
GACGCAAGATTTCCATGGCAATTATGTCCATTTTGACTTTCATATTTCTT
CTTCCACTGCTTATCCATCAACCTGTTACTTTAACAACAGTATTATTATT
TGGAGCTCGAATGTTTGCCAATGGGACCTTTGCCGTTGCTTGCGTGTATG
CACCAGAGGTGTATCCAACCTCACTGAGGGCAACTGGTGCCGGCATTGCA
AGTGCAGTGGGACGAATTGGGGGCATGGTGTGCCCTCTAGTATCCGTTGG
ATTGGTGACCGGTTGCCATCAGACGGCTGCCATCTTTCTCTTGGCGGTTG
TGATTGTTCTCTCAATAGTTTGCATACTTCTCTTCCCATTTGAAACCAAG
GGCAAAAGGATTGACTGACACCGTTGCTGTTGTATTCAATATGGTTTCAA
GGGAAAAAAAAAAAAAATCATTAATTTGCAAACAGTTGTTCGTCTTCAGT
CGATGCAGCGAGTCATTGGCTACTTTAACTTAGAGCATGTGCCATTCTGT
GGACAGGTGGGCAGGCGCTCTGCACATGCCCGCGATCCCGATTATTTCAT
TTCTATAATAAGTGATACATTGATTTTTATGAGAATGACATCATTTACGT
TACGTAATCTATTA
back to top