FC931427

Overview
NameFC931427
Unique NameFC931427
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length640
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10254 contig Ccv1_Contig10254:232..871. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931427 vs. ExPASy Swiss-Prot
Match: SAHH1_ARATH (Adenosylhomocysteinase 1 OS=Arabidopsis thaliana GN=SAHH1 PE=1 SV=1)

HSP 1 Score: 383.259 bits (983), Expect = 5.819e-106
Identity = 181/210 (86.19%), Postives = 191/210 (90.95%), Query Frame = 3
Query:    3 MPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKADPKKYHKMKERLVGVSEETTTGVKRFYQMQENGTLLFPAINVNDSVTKSKFDNLYGCR 632
            MPGLMACR EFGPSQPFKGA+ITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEI+EKTG++PDP STDN EFQIVL+II++GL+ DPKKYHKMKERLVGVSEETTTGVKR YQMQ+NGTLLFPAINVNDSVTKSKFDNLYGCR
Sbjct:   36 MPGLMACRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQQNGTLLFPAINVNDSVTKSKFDNLYGCR 245          
BLAST of FC931427 vs. ExPASy Swiss-Prot
Match: SAHH_PETCR (Adenosylhomocysteinase OS=Petroselinum crispum GN=SAHH PE=2 SV=2)

HSP 1 Score: 377.867 bits (969), Expect = 2.445e-104
Identity = 179/210 (85.24%), Postives = 189/210 (90.00%), Query Frame = 3
Query:    3 MPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKADPKKYHKMKERLVGVSEETTTGVKRFYQMQENGTLLFPAINVNDSVTKSKFDNLYGCR 632
            MPGLM+CR EFGPSQPFKGA+ITGSLHMTIQT VLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y+K+G +PDPASTDNAEFQIVL+IIRDGLK+DP KYHKMK+RLVGVSEETTTGVKR YQMQ+NGTLLFPAINVNDSVTKSKFDNLYGCR
Sbjct:   36 MPGLMSCRTEFGPSQPFKGARITGSLHMTIQTGVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSCAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYKKSGAIPDPASTDNAEFQIVLSIIRDGLKSDPMKYHKMKDRLVGVSEETTTGVKRLYQMQQNGTLLFPAINVNDSVTKSKFDNLYGCR 245          
BLAST of FC931427 vs. ExPASy Swiss-Prot
Match: SAHH_CATRO (Adenosylhomocysteinase OS=Catharanthus roseus GN=SAHH PE=2 SV=1)

HSP 1 Score: 376.326 bits (965), Expect = 7.114e-104
Identity = 181/210 (86.19%), Postives = 188/210 (89.52%), Query Frame = 3
Query:    3 MPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKADPKKYHKMKERLVGVSEETTTGVKRFYQMQENGTLLFPAINVNDSVTKSKFDNLYGCR 632
            MPGLM+CRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQ+H              WKGETLQEYWWCTE+ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y+K G LPDP+STDNAEFQIVLTIIRDGLK+DP KY +MKERLVGVSEETTTGVKR YQMQ NGTLLFPAINVNDSVTKSKFDNLYGCR
Sbjct:   36 MPGLMSCRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQEHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYKKNGALPDPSSTDNAEFQIVLTIIRDGLKSDPTKYTRMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCR 245          
BLAST of FC931427 vs. ExPASy Swiss-Prot
Match: SAHH_LUPLU (Adenosylhomocysteinase OS=Lupinus luteus GN=SAHH PE=2 SV=1)

HSP 1 Score: 375.555 bits (963), Expect = 1.213e-103
Identity = 178/210 (84.76%), Postives = 189/210 (90.00%), Query Frame = 3
Query:    3 MPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKADPKKYHKMKERLVGVSEETTTGVKRFYQMQENGTLLFPAINVNDSVTKSKFDNLYGCR 632
            MPGLMA R+EFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ALDWGPGGGPDLIVDDGGD TLLIHEGVKAEEIYEK+G+ PDP STDNAEF+IVL+II++GLK DPK+YHKMK+R+VGVSEETTTGVKR YQMQ NGTLLFPAINVNDSVTKSKFDNLYGCR
Sbjct:   36 MPGLMASRSEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDTTLLIHEGVKAEEIYEKSGQFPDPDSTDNAEFKIVLSIIKEGLKTDPKRYHKMKDRVVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCR 245          
BLAST of FC931427 vs. ExPASy Swiss-Prot
Match: SAHH_MEDSA (Adenosylhomocysteinase OS=Medicago sativa GN=SAHH PE=2 SV=1)

HSP 1 Score: 375.17 bits (962), Expect = 1.585e-103
Identity = 177/210 (84.29%), Postives = 188/210 (89.52%), Query Frame = 3
Query:    3 MPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKADPKKYHKMKERLVGVSEETTTGVKRFYQMQENGTLLFPAINVNDSVTKSKFDNLYGCR 632
            MPGLM+CR EFGPSQPFKGA+ITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWC+E+ALDWGPGGGPDLIVDDGGD TLLIHEGVKAEE++EKTG+LPDP+STDNAE QIVLTIIRDGLK DPK+Y KMK R+VGVSEETTTGVKR YQMQ +GTLLFPAINVNDSVTKSKFDNLYGCR
Sbjct:   36 MPGLMSCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCSERALDWGPGGGPDLIVDDGGDVTLLIHEGVKAEEVFEKTGQLPDPSSTDNAEMQIVLTIIRDGLKTDPKRYQKMKTRIVGVSEETTTGVKRLYQMQASGTLLFPAINVNDSVTKSKFDNLYGCR 245          
BLAST of FC931427 vs. ExPASy Swiss-Prot
Match: SAHH_TOBAC (Adenosylhomocysteinase OS=Nicotiana tabacum GN=SAHH PE=2 SV=1)

HSP 1 Score: 370.548 bits (950), Expect = 3.903e-102
Identity = 178/210 (84.76%), Postives = 184/210 (87.62%), Query Frame = 3
Query:    3 MPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKADPKKYHKMKERLVGVSEETTTGVKRFYQMQENGTLLFPAINVNDSVTKSKFDNLYGCR 632
            MPGLMACR EFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G +PDP STDNAEFQ+VLTII++ LK DP KY KMKERLVGVSEETTTGVKR YQMQ NGTLLFPAINVNDSVTKSKFDNLYGCR
Sbjct:   36 MPGLMACRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTIPDPNSTDNAEFQLVLTIIKESLKTDPLKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCR 245          
BLAST of FC931427 vs. ExPASy Swiss-Prot
Match: SAHH_NICSY (Adenosylhomocysteinase OS=Nicotiana sylvestris GN=SAHH PE=2 SV=1)

HSP 1 Score: 370.548 bits (950), Expect = 3.903e-102
Identity = 178/210 (84.76%), Postives = 184/210 (87.62%), Query Frame = 3
Query:    3 MPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKADPKKYHKMKERLVGVSEETTTGVKRFYQMQENGTLLFPAINVNDSVTKSKFDNLYGCR 632
            MPGLMACR EFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G +PDP STDNAEFQ+VLTII++ LK DP KY KMKERLVGVSEETTTGVKR YQMQ NGTLLFPAINVNDSVTKSKFDNLYGCR
Sbjct:   36 MPGLMACRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTIPDPNSTDNAEFQLVLTIIKESLKTDPLKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCR 245          
BLAST of FC931427 vs. ExPASy Swiss-Prot
Match: SAHH_MESCR (Adenosylhomocysteinase OS=Mesembryanthemum crystallinum GN=SAHH PE=2 SV=1)

HSP 1 Score: 370.163 bits (949), Expect = 5.098e-102
Identity = 177/210 (84.29%), Postives = 182/210 (86.67%), Query Frame = 3
Query:    3 MPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKADPKKYHKMKERLVGVSEETTTGVKRFYQMQENGTLLFPAINVNDSVTKSKFDNLYGCR 632
            MPGLMACR EFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ALDWG GGGPDLIVDDGGDATLLIHEGVKAEE YEK G +PDP STDN EFQ+VL +IRD LK DPK+YHKMK RLVGVSEETTTGVKR YQMQ  GTLLFPAINVNDSVTKSKFDNLYGCR
Sbjct:   36 MPGLMACRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGAGGGPDLIVDDGGDATLLIHEGVKAEEEYEKNGTIPDPTSTDNPEFQLVLGLIRDSLKVDPKRYHKMKTRLVGVSEETTTGVKRLYQMQATGTLLFPAINVNDSVTKSKFDNLYGCR 245          
BLAST of FC931427 vs. ExPASy Swiss-Prot
Match: SAHH_PHASS (Adenosylhomocysteinase OS=Phalaenopsis sp. GN=SAHH PE=2 SV=1)

HSP 1 Score: 369.777 bits (948), Expect = 6.658e-102
Identity = 177/210 (84.29%), Postives = 185/210 (88.10%), Query Frame = 3
Query:    3 MPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKADPKKYHKMKERLVGVSEETTTGVKRFYQMQENGTLLFPAINVNDSVTKSKFDNLYGCR 632
            MPGLMACRAEFGPSQPFKGA+I+GSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ L+WG GGGPDLIVDDGGDATLLIHEGVKAEE YEK GK+PDPASTDNAEFQIVL +IRD L  DPKKY +MKERLVGVSEETTTGVKR YQMQ +GTLLFPAINVNDSVTKSKFDNLYGCR
Sbjct:   36 MPGLMACRAEFGPSQPFKGARISGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERCLEWGAGGGPDLIVDDGGDATLLIHEGVKAEEEYEKNGKIPDPASTDNAEFQIVLGLIRDSLSVDPKKYRRMKERLVGVSEETTTGVKRLYQMQYSGTLLFPAINVNDSVTKSKFDNLYGCR 245          
BLAST of FC931427 vs. ExPASy Swiss-Prot
Match: SAHH2_ARATH (Adenosylhomocysteinase 2 OS=Arabidopsis thaliana GN=SAHH2 PE=1 SV=1)

HSP 1 Score: 368.237 bits (944), Expect = 1.937e-101
Identity = 175/210 (83.33%), Postives = 183/210 (87.14%), Query Frame = 3
Query:    3 MPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKADPKKYHKMKERLVGVSEETTTGVKRFYQMQENGTLLFPAINVNDSVTKSKFDNLYGCR 632
            MPGL++C  EFGPSQP KGA+ITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEI+ K G  PDP STDN EFQIVL+II+DGL+ DPKKYHKMKERLVGVSEETTTGVKR YQMQE G LLFPAINVNDSVTKSKFDNLYGCR
Sbjct:   36 MPGLVSCVTEFGPSQPLKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKNGTFPDPTSTDNPEFQIVLSIIKDGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGCR 245          
The following BLAST results are available for this feature:
BLAST of FC931427 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
SAHH1_ARATH5.819e-10686.19Adenosylhomocysteinase 1 OS=Arabidopsis thaliana G... [more]
SAHH_PETCR2.445e-10485.24Adenosylhomocysteinase OS=Petroselinum crispum GN=... [more]
SAHH_CATRO7.114e-10486.19Adenosylhomocysteinase OS=Catharanthus roseus GN=S... [more]
SAHH_LUPLU1.213e-10384.76Adenosylhomocysteinase OS=Lupinus luteus GN=SAHH P... [more]
SAHH_MEDSA1.585e-10384.29Adenosylhomocysteinase OS=Medicago sativa GN=SAHH ... [more]
SAHH_TOBAC3.903e-10284.76Adenosylhomocysteinase OS=Nicotiana tabacum GN=SAH... [more]
SAHH_NICSY3.903e-10284.76Adenosylhomocysteinase OS=Nicotiana sylvestris GN=... [more]
SAHH_MESCR5.098e-10284.29Adenosylhomocysteinase OS=Mesembryanthemum crystal... [more]
SAHH_PHASS6.658e-10284.29Adenosylhomocysteinase OS=Phalaenopsis sp. GN=SAHH... [more]
SAHH2_ARATH1.937e-10183.33Adenosylhomocysteinase 2 OS=Arabidopsis thaliana G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34105A04EF PostHarvP1 Citrus clementina cDNA clone C34105A04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931427 ID=FC931427|Name=FC931427|organism=Citrus clementina|type=EST|length=640bp
AAATGCCGGGGCTCATGGCTTGCCGCGCCGAGTTCGGCCCTTCACAGCCC
TTCAAAGGAGCCAAGATCACCGGTTCACTCCACATGACCATCCAGACCGC
CGTCCTCATCGAGACCCTCACCGCTCTCGGCGCCGAAGTCCGCTGGTGCT
CCTGCAACATCTTCTCAACCCAAGACCACGCGGCCGCCGCCATCGCACGT
GACTCCGCCTCCGTCTTTGCCTGGAAGGGTGAGACCCTCCAGGAGTACTG
GTGGTGCACGGAGAAAGCCCTGGACTGGGGTCCCGGCGGCGGCCCAGATC
TCATCGTCGATGACGGTGGTGACGCCACGTTGTTGATCCACGAGGGAGTC
AAAGCTGAGGAGATCTACGAGAAGACCGGGAAGTTGCCCGACCCGGCCTC
CACCGACAACGCCGAGTTTCAGATTGTTTTGACTATCATTAGAGATGGGT
TGAAGGCCGATCCCAAGAAGTACCACAAAATGAAGGAAAGATTAGTTGGT
GTTTCCGAAGAAACCACGACCGGTGTCAAGAGATTTTATCAGATGCAAGA
AAATGGAACCCTCTTGTTCCCTGCCATCAATGTCAATGACTCTGTCACCA
AGAGCAAGTTTGATAACTTGTATGGATGCCGCACTCGCTC
back to top