FC931428

Overview
NameFC931428
Unique NameFC931428
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length718
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10223 contig Ccv1_Contig10223:1..719. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931428 vs. ExPASy Swiss-Prot
Match: APX2_ARATH (L-ascorbate peroxidase 2, cytosolic OS=Arabidopsis thaliana GN=APX2 PE=2 SV=3)

HSP 1 Score: 282.337 bits (721), Expect = 3.478e-87
Identity = 133/172 (77.33%), Postives = 151/172 (87.79%), Query Frame = 3
Query:   81 KNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGLVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSG 596
            K+YP V E+YKKAV++CKRKLRG IAEK+CAP++LR+AWHSAGT+DVKTKTGGPFGT+R   E AH ANNGLDIAVRLL+P KE FP +SYAD YQLAG+V VE+TGGP+IPFHPGR DK EPP EGRLP A +G DHLR VFG +MGL+DKDIVALSGGHTLGRCHKERSG
Sbjct:    4 KSYPEVKEEYKKAVQRCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDVKTKTGGPFGTIRHPQELAHDANNGLDIAVRLLDPIKELFPILSYADFYQLAGVVAVEITGGPEIPFHPGRLDKVEPPPEGRLPQATKGVDHLRDVFG-RMGLNDKDIVALSGGHTLGRCHKERSG 174          

HSP 2 Score: 61.2326 bits (147), Expect = 3.478e-87
Identity = 28/40 (70.00%), Postives = 32/40 (80.00%), Query Frame = 2
Query:  599 EGPWTRHPLIFDNSYFTELLTGEKGWSSALPSDKALLDDP 718
            EG WT +PLIFDNSYF E+L+GEK     LP+DKALLDDP
Sbjct:  176 EGAWTPNPLIFDNSYFKEILSGEKEGLLQLPTDKALLDDP 215          
BLAST of FC931428 vs. ExPASy Swiss-Prot
Match: APX1_ARATH (L-ascorbate peroxidase 1, cytosolic OS=Arabidopsis thaliana GN=APX1 PE=1 SV=2)

HSP 1 Score: 299.286 bits (765), Expect = 1.359e-80
Identity = 146/205 (71.22%), Postives = 169/205 (82.44%), Query Frame = 3
Query:   75 MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGLVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGLRDHGPXTLSFLTIPTSRSS*LV--RKDGLL 683
            MTKNYPTVSEDYKKAVEKC+RKLRG IAEKNCAP+M+R+AWHSAGT+D +++TGGPFGTMR  AEQAH AN+G+ IA+RLL+P +EQFPTIS+AD +QLAG+V VEVTGGPDIPFHPGR+DK +PP EGRLPDA +G DHLR VF  QMGLSDKDIVALSG HTLGRCHK+RSG    G  T + L    S    L+   K+GLL
Sbjct:    1 MTKNYPTVSEDYKKAVEKCRRKLRGLIAEKNCAPIMVRLAWHSAGTFDCQSRTGGPFGTMRFDAEQAHGANSGIHIALRLLDPIREQFPTISFADFHQLAGVVAVEVTGGPDIPFHPGREDKPQPPPEGRLPDATKGCDHLRDVFAKQMGLSDKDIVALSGAHTLGRCHKDRSGF--EGAWTSNPLIFDNSYFKELLSGEKEGLL 203          
BLAST of FC931428 vs. ExPASy Swiss-Prot
Match: APX1_PEA (L-ascorbate peroxidase, cytosolic OS=Pisum sativum GN=APX1 PE=1 SV=2)

HSP 1 Score: 296.59 bits (758), Expect = 8.808e-80
Identity = 146/205 (71.22%), Postives = 167/205 (81.46%), Query Frame = 3
Query:   75 MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGLVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGLRDHGPXTLSFLTIPTSRSS*LV--RKDGLL 683
            M K+YPTVS DY+KA+EK KRKLRGFIAEK CAPL+LR+AWHSAGT+D KTKTGGPFGT++  AE AH ANNGLDIAVRLLEP KEQFP +SYAD YQLAG+V VE+TGGP++PFHPGR+DK EPP EGRLPDA +G+DHLR VFG  MGLSD+DIVALSGGHT+G  HKERSG    GP T + L    S  + L+   KDGLL
Sbjct:    1 MGKSYPTVSPDYQKAIEKAKRKLRGFIAEKKCAPLILRLAWHSAGTFDSKTKTGGPFGTIKHQAELAHGANNGLDIAVRLLEPIKEQFPIVSYADFYQLAGVVAVEITGGPEVPFHPGREDKPEPPPEGRLPDATKGSDHLRDVFGKAMGLSDQDIVALSGGHTIGAAHKERSGF--EGPWTSNPLIFDNSYFTELLTGEKDGLL 203          
BLAST of FC931428 vs. ExPASy Swiss-Prot
Match: APX2_ORYSJ (L-ascorbate peroxidase 2, cytosolic OS=Oryza sativa subsp. japonica GN=APX2 PE=1 SV=1)

HSP 1 Score: 292.352 bits (747), Expect = 1.661e-78
Identity = 145/204 (71.08%), Postives = 166/204 (81.37%), Query Frame = 3
Query:   78 TKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGLVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGLRDHGPXTLSFLTIPTSRSS*LV--RKDGLL 683
            +K+YPTVS++Y  AV K KRKLRG IAEKNCAPLMLR+AWHSAGT+DV ++TGGPFGTM+   EQ+H+AN GLDIAVRLL+P K+Q P +SYAD YQLAG+V VEVTGGP++PFHPGR DK EPP EGRLPDA QG+DHLRQVF AQMGLSDKDIVALSGGHTLGRCHKERSG    G  T + L    S  + LV   K+GLL
Sbjct:    3 SKSYPTVSDEYLAAVGKAKRKLRGLIAEKNCAPLMLRLAWHSAGTFDVSSRTGGPFGTMKNPGEQSHAANAGLDIAVRLLDPIKDQLPILSYADFYQLAGVVAVEVTGGPEVPFHPGRQDKPEPPPEGRLPDATQGSDHLRQVFSAQMGLSDKDIVALSGGHTLGRCHKERSGF--EGAWTSNPLIFDNSYFTELVSGEKEGLL 204          
BLAST of FC931428 vs. ExPASy Swiss-Prot
Match: APX1_ORYSJ (L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. japonica GN=APX1 PE=1 SV=1)

HSP 1 Score: 290.812 bits (743), Expect = 4.833e-78
Identity = 143/205 (69.76%), Postives = 168/205 (81.95%), Query Frame = 3
Query:   75 MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGLVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGLRDHGPXTLSFLTIPTSRSS*LVR--KDGLL 683
            M KNYP VS +Y++AVEK ++KLR  IAEK+CAPLMLR+AWHSAGT+DV +KTGGPFGTM+  AE +H+AN GLDIAVR+LEP KE+ PTISYAD YQLAG+V VEV+GGP +PFHPGR+DK  PP EGRLPDA +G+DHLRQVFGAQMGLSD+DIVALSGGHTLGRCHKERSG    GP T + L    S  + L+   K+GLL
Sbjct:    1 MAKNYPVVSAEYQEAVEKARQKLRALIAEKSCAPLMLRLAWHSAGTFDVSSKTGGPFGTMKTPAELSHAANAGLDIAVRMLEPIKEEIPTISYADFYQLAGVVAVEVSGGPAVPFHPGREDKPAPPPEGRLPDATKGSDHLRQVFGAQMGLSDQDIVALSGGHTLGRCHKERSGF--EGPWTRNPLQFDNSYFTELLSGDKEGLL 203          
BLAST of FC931428 vs. ExPASy Swiss-Prot
Match: APX1_ORYSI (L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. indica GN=APX1 PE=2 SV=1)

HSP 1 Score: 290.812 bits (743), Expect = 4.833e-78
Identity = 143/205 (69.76%), Postives = 168/205 (81.95%), Query Frame = 3
Query:   75 MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGLVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGLRDHGPXTLSFLTIPTSRSS*LVR--KDGLL 683
            M KNYP VS +Y++AVEK ++KLR  IAEK+CAPLMLR+AWHSAGT+DV +KTGGPFGTM+  AE +H+AN GLDIAVR+LEP KE+ PTISYAD YQLAG+V VEV+GGP +PFHPGR+DK  PP EGRLPDA +G+DHLRQVFGAQMGLSD+DIVALSGGHTLGRCHKERSG    GP T + L    S  + L+   K+GLL
Sbjct:    1 MAKNYPVVSAEYQEAVEKARQKLRALIAEKSCAPLMLRLAWHSAGTFDVSSKTGGPFGTMKTPAELSHAANAGLDIAVRMLEPIKEEIPTISYADFYQLAGVVAVEVSGGPAVPFHPGREDKPAPPPEGRLPDATKGSDHLRQVFGAQMGLSDQDIVALSGGHTLGRCHKERSGF--EGPWTRNPLQFDNSYFTELLSGDKEGLL 203          
BLAST of FC931428 vs. ExPASy Swiss-Prot
Match: APX3_ARATH (L-ascorbate peroxidase 3, peroxisomal OS=Arabidopsis thaliana GN=APX3 PE=1 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 1.857e-67
Identity = 113/177 (63.84%), Postives = 130/177 (73.45%), Query Frame = 3
Query:   90 PTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGLVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGLRDHGPXT 620
            P V  +Y K + K +R+LR  IA KNCAP+MLR+AWH AGTYD ++KTGGP G++R   E  H AN+GL IA+ L E  K + P I+YADLYQLAG+V VEVTGGPDI F PGR D    P+EGRLPDAKQG  HLR VF  +MGLSDKDIVALSGGHTLGR H ERSG    GP T
Sbjct:    4 PIVDAEYLKEITKARRELRSLIANKNCAPIMLRLAWHDAGTYDAQSKTGGPNGSIRNEEEHTHGANSGLKIALDLCEGVKAKHPKITYADLYQLAGVVAVEVTGGPDIVFVPGRKDSNVCPKEGRLPDAKQGFQHLRDVF-YRMGLSDKDIVALSGGHTLGRAHPERSGF--DGPWT 177          

HSP 2 Score: 56.6102 bits (135), Expect = 1.857e-67
Identity = 25/40 (62.50%), Postives = 29/40 (72.50%), Query Frame = 2
Query:  599 EGPWTRHPLIFDNSYFTELLTGEKGWSSALPSDKALLDDP 718
            +GPWT+ PL FDNSYF ELL GE      LP+DK LL+DP
Sbjct:  173 DGPWTQEPLKFDNSYFVELLKGESEGLLKLPTDKTLLEDP 212          
BLAST of FC931428 vs. ExPASy Swiss-Prot
Match: APX4_ORYSJ (Probable L-ascorbate peroxidase 4 OS=Oryza sativa subsp. japonica GN=APX4 PE=2 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 3.753e-65
Identity = 105/169 (62.13%), Postives = 126/169 (74.56%), Query Frame = 3
Query:   90 PTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGLVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSG 596
            P V  +Y + V++ +R LR  I+ K CAP+MLR+AWH AGTYDV TKTGG  G++R   E  H +N GL IA+ LLEP K + P I+YADLYQLAG+V VEVTGGP + F PGR D +  P+EGRLPDAK+G  HLR +F  +MGLSDKDIVALSGGHTLGR H ERSG
Sbjct:    4 PVVDAEYLRQVDRARRHLRALISSKGCAPIMLRLAWHDAGTYDVNTKTGGANGSIRYEEEYTHGSNAGLKIAIDLLEPIKAKSPKITYADLYQLAGVVAVEVTGGPTVEFIPGRRDSSVCPREGRLPDAKKGALHLRDIF-YRMGLSDKDIVALSGGHTLGRAHPERSG 171          

HSP 2 Score: 55.8398 bits (133), Expect = 3.753e-65
Identity = 26/40 (65.00%), Postives = 29/40 (72.50%), Query Frame = 2
Query:  599 EGPWTRHPLIFDNSYFTELLTGEKGWSSALPSDKALLDDP 718
            EG WT+ PL FDNSYF ELL GE      LP+DKALL+DP
Sbjct:  173 EGAWTQEPLKFDNSYFLELLKGESEGLLKLPTDKALLEDP 212          
BLAST of FC931428 vs. ExPASy Swiss-Prot
Match: APX3_ORYSJ (Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. japonica GN=APX3 PE=2 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 1.085e-64
Identity = 106/169 (62.72%), Postives = 130/169 (76.92%), Query Frame = 3
Query:   90 PTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGLVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSG 596
            P V  +Y   VE+ +R LR  IA K+CAP+MLR+AWH AGTYD  TKTGGP G++R   E +H+AN G+ IA+ LLEP K++ P I+YADLYQLAG+V VEVTGGP I + PGR D ++ P+EGRLPDAK+G  HLR+VF  +MGLSDKDIVALSGGHTLG+   ERSG
Sbjct:    5 PVVDAEYMAEVERARRDLRALIASKSCAPIMLRLAWHDAGTYDKATKTGGPNGSIRFPQEYSHAANAGIKIAIDLLEPMKQKHPKITYADLYQLAGVVAVEVTGGPTIDYVPGRRDSSDSPEEGRLPDAKKGAAHLREVF-YRMGLSDKDIVALSGGHTLGKARPERSG 172          

HSP 2 Score: 49.2914 bits (116), Expect = 1.085e-64
Identity = 24/50 (48.00%), Postives = 29/50 (58.00%), Query Frame = 2
Query:  569 GKVPQGEVWIEGPWTRHPLIFDNSYFTELLTGEKGWSSALPSDKALLDDP 718
            GK        +G WT+ PL FDNSYF ELL         LP+DKAL++DP
Sbjct:  164 GKARPERSGFDGAWTKDPLKFDNSYFIELLKENSEGLLKLPTDKALVEDP 213          
BLAST of FC931428 vs. ExPASy Swiss-Prot
Match: APX3_ORYSI (Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. indica GN=APX3 PE=2 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 1.085e-64
Identity = 106/169 (62.72%), Postives = 130/169 (76.92%), Query Frame = 3
Query:   90 PTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGLVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSG 596
            P V  +Y   VE+ +R LR  IA K+CAP+MLR+AWH AGTYD  TKTGGP G++R   E +H+AN G+ IA+ LLEP K++ P I+YADLYQLAG+V VEVTGGP I + PGR D ++ P+EGRLPDAK+G  HLR+VF  +MGLSDKDIVALSGGHTLG+   ERSG
Sbjct:    5 PVVDAEYMAEVERARRDLRALIASKSCAPIMLRLAWHDAGTYDKATKTGGPNGSIRFPQEYSHAANAGIKIAIDLLEPMKQRHPKITYADLYQLAGVVAVEVTGGPTIDYVPGRRDSSDSPEEGRLPDAKKGAAHLREVF-YRMGLSDKDIVALSGGHTLGKARPERSG 172          

HSP 2 Score: 49.2914 bits (116), Expect = 1.085e-64
Identity = 24/50 (48.00%), Postives = 29/50 (58.00%), Query Frame = 2
Query:  569 GKVPQGEVWIEGPWTRHPLIFDNSYFTELLTGEKGWSSALPSDKALLDDP 718
            GK        +G WT+ PL FDNSYF ELL         LP+DKAL++DP
Sbjct:  164 GKARPERSGFDGAWTKDPLKFDNSYFIELLKENSEGLLKLPTDKALVEDP 213          
The following BLAST results are available for this feature:
BLAST of FC931428 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 80
Match NameE-valueIdentityDescription
APX2_ARATH3.478e-8777.33L-ascorbate peroxidase 2, cytosolic OS=Arabidopsis... [more]
APX1_ARATH1.359e-8071.22L-ascorbate peroxidase 1, cytosolic OS=Arabidopsis... [more]
APX1_PEA8.808e-8071.22L-ascorbate peroxidase, cytosolic OS=Pisum sativum... [more]
APX2_ORYSJ1.661e-7871.08L-ascorbate peroxidase 2, cytosolic OS=Oryza sativ... [more]
APX1_ORYSJ4.833e-7869.76L-ascorbate peroxidase 1, cytosolic OS=Oryza sativ... [more]
APX1_ORYSI4.833e-7869.76L-ascorbate peroxidase 1, cytosolic OS=Oryza sativ... [more]
APX3_ARATH1.857e-6763.84L-ascorbate peroxidase 3, peroxisomal OS=Arabidops... [more]
APX4_ORYSJ3.753e-6562.13Probable L-ascorbate peroxidase 4 OS=Oryza sativa ... [more]
APX3_ORYSJ1.085e-6462.72Probable L-ascorbate peroxidase 3 OS=Oryza sativa ... [more]
APX3_ORYSI1.085e-6462.72Probable L-ascorbate peroxidase 3 OS=Oryza sativa ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34105A05EF PostHarvP1 Citrus clementina cDNA clone C34105A05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931428 ID=FC931428|Name=FC931428|organism=Citrus clementina|type=EST|length=718bp
GGTGCTCTGCTCGTGCCACTCTCGTTTGTTAAGGATTTGCGTCTCTCTTT
CTCATTTCATTCAGCGTTGAAAAGATGACGAAGAATTACCCCACTGTTAG
CGAGGATTACAAGAAGGCCGTGGAGAAATGCAAGAGGAAGCTCAGAGGCT
TCATCGCTGAGAAGAACTGCGCTCCACTCATGCTCCGTATCGCGTGGCAC
TCAGCTGGTACATATGATGTGAAGACCAAGACCGGAGGTCCATTCGGAAC
CATGAGGCTCGCTGCTGAGCAGGCACACTCAGCCAACAACGGCCTCGATA
TTGCCGTTAGGCTTTTGGAGCCGTTCAAGGAGCAGTTCCCTACCATCTCC
TACGCTGACCTTTATCAGCTTGCTGGTCTTGTTGGCGTTGAGGTTACCGG
TGGGCCCGATATCCCCTTCCACCCTGGAAGAGATGACAAGGCTGAGCCAC
CTCAAGAAGGCCGGCTTCCTGATGCTAAACAGGGTAATGATCACTTGAGG
CAAGTCTTTGGTGCTCAGATGGGCCTCAGCGACAAGGATATTGTTGCTCT
CTCTGGTGGCCACACCCTGGGAAGGTGCCACAAGGAGAGGTCTGGATTGA
GGGACCATGGACCCGNCACCCTCTCATTTTTGACAATTCCTACTTCACGG
AGCTCTTGACTGGTGAGAAAGGATGGTCTTCTGCATTGCCATCCGACAAG
GCCCTTCTGGATGACCCT
back to top