FC931429

Overview
NameFC931429
Unique NameFC931429
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length713
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15323 contig Ccv1_Contig15323:1..713. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: AB40G_ARATH (ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 1.652e-70
Identity = 126/234 (53.85%), Postives = 160/234 (68.38%), Query Frame = 2
Query:    2 DLGGRTKRNQDLFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDDKKMDTGETVKQFLKDYFDFKHDXXXXXXXXXXXXXXXXXXXXXXXIKMFNFQKR 703
            DLGG+TK  QDL NAMG M+TAVLFLG+Q  +SVQP+V+VERTVFYRE+AAGMY+ +P+A AQV IEIPY+LVQ++VYG IVYAMIGFEWTA KFFWY+               MAVA+TPNHHIA++VS+ FYG+WN+FSGF+            YYW  P+AWTLYGL+ASQFGD+ +   D+  +VKQF+++++ ++                         IK FNFQKR
Sbjct: 1190 DLGGKTKTRQDLSNAMGSMYTAVLFLGLQNAASVQPVVNVERTVFYREQAAGMYSAMPYAFAQVFIEIPYVLVQAIVYGLIVYAMIGFEWTAVKFFWYLFFMYGSFLTFTFYGMMAVAMTPNHHIASVVSSAFYGIWNLFSGFLIPRPSMPVWWEWYYWLCPVAWTLYGLIASQFGDITEPMADSNMSVKQFIREFYGYREGFLGVVAAMNVIFPLLFAVIFAIGIKSFNFQKR 1423          
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: PDR1_TOBAC (Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 6.939e-69
Identity = 129/234 (55.13%), Postives = 153/234 (65.38%), Query Frame = 2
Query:    2 DLGGRTKRNQDLFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDDKKMDTGETVKQFLKDYFDFKHDXXXXXXXXXXXXXXXXXXXXXXXIKMFNFQKR 703
            DLG +  ++QDL NAMG M+ AVLFLGVQ  SSVQP+V++ERTVFYRE+AAGMY+ IP+A  QV IEIPYI VQSV YG IVYAMIGFEW   KFFWY+               M VA+TPN ++A+IV+  FYG+WN+FSGF+            YYWANP+AWTLYGLVASQFGD+  K  D  ETV+QFL+ YF FKHD                       IK FNFQ+R
Sbjct: 1202 DLGTKVSKSQDLLNAMGSMYAAVLFLGVQNASSVQPVVAIERTVFYRERAAGMYSAIPYAFGQVSIEIPYIFVQSVFYGIIVYAMIGFEWDVGKFFWYLFIMFFTLLYFTFYGMMGVAVTPNQNVASIVAAFFYGVWNLFSGFIIPRPRMPVWWRWYYWANPVAWTLYGLVASQFGDIQTKLSD-NETVEQFLRRYFGFKHDFLGVVAAVLTAYVFMFAFTFAFAIKAFNFQRR 1434          
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: PDR3_ORYSJ (Pleiotropic drug resistance protein 3 OS=Oryza sativa subsp. japonica GN=PDR3 PE=2 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 5.874e-68
Identity = 128/234 (54.70%), Postives = 154/234 (65.81%), Query Frame = 2
Query:    2 DLGGRTKRNQDLFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDDKKMDTGETVKQFLKDYFDFKHDXXXXXXXXXXXXXXXXXXXXXXXIKMFNFQKR 703
            DLGG+  ++QDLFNAMG M+ AVLF+GV  C+SVQP+V+VERTVFYRE+AAGMY+  P+A  QV+IEIPY LVQ+ VYG IVYAMIGFEWTAAKFFWY+               MAV LTPN+HIA+IVS+ FY +WN+FSGFV            Y WA P+AWTLYGLV SQFGD+ +  M+ G  VK F+++YF FKH                        I  FNFQKR
Sbjct: 1225 DLGGKVTKSQDLFNAMGSMYAAVLFIGVMNCTSVQPVVAVERTVFYRERAAGMYSAFPYAFGQVVIEIPYTLVQATVYGIIVYAMIGFEWTAAKFFWYLFFMVFTLLYFTFYGMMAVGLTPNYHIASIVSSAFYAIWNLFSGFVIPRPRVPIWWRWYCWACPVAWTLYGLVVSQFGDI-ETPMEDGTPVKVFVENYFGFKHSWLGWVATVVAAFAFLFASLFGFAIMKFNFQKR 1457          
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: PDR3_ORYSI (Pleiotropic drug resistance protein 3 OS=Oryza sativa subsp. indica GN=PDR3 PE=2 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 5.874e-68
Identity = 128/234 (54.70%), Postives = 154/234 (65.81%), Query Frame = 2
Query:    2 DLGGRTKRNQDLFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDDKKMDTGETVKQFLKDYFDFKHDXXXXXXXXXXXXXXXXXXXXXXXIKMFNFQKR 703
            DLGG+  ++QDLFNAMG M+ AVLF+GV  C+SVQP+V+VERTVFYRE+AAGMY+  P+A  QV+IEIPY LVQ+ VYG IVYAMIGFEWTAAKFFWY+               MAV LTPN+HIA+IVS+ FY +WN+FSGFV            Y WA P+AWTLYGLV SQFGD+ +  M+ G  VK F+++YF FKH                        I  FNFQKR
Sbjct: 1225 DLGGKVTKSQDLFNAMGSMYAAVLFIGVMNCTSVQPVVAVERTVFYRERAAGMYSAFPYAFGQVVIEIPYTLVQATVYGIIVYAMIGFEWTAAKFFWYLFFMVFTLLYFTFYGMMAVGLTPNYHIASIVSSAFYAIWNLFSGFVIPRPRVPIWWRWYCWACPVAWTLYGLVVSQFGDI-ETPMEDGTPVKVFVENYFGFKHSWLGWVATVVAAFAFLFASLFGFAIMKFNFQKR 1457          
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: PDR1_NICPL (Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 5.874e-68
Identity = 129/234 (55.13%), Postives = 151/234 (64.53%), Query Frame = 2
Query:    2 DLGGRTKRNQDLFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDDKKMDTGETVKQFLKDYFDFKHDXXXXXXXXXXXXXXXXXXXXXXXIKMFNFQKR 703
            D+G +  RNQDL NAMG M+ AVLFLGVQ  SSVQP+VSVERTVFYREKAAGMY+ IP+A AQV+IEIPYI VQ+ VYG IVY+MIGFEWT AKFFW                 M VA+TPN ++A+IV+  FY +WN+FSGF+            YYW  PIAWTLYGLVASQFGD+ D   D  +TV+QFL+  F FKHD                       IK FNFQ+R
Sbjct: 1203 DIGTKVSRNQDLVNAMGSMYAAVLFLGVQNSSSVQPVVSVERTVFYREKAAGMYSAIPYAFAQVLIEIPYIFVQATVYGLIVYSMIGFEWTVAKFFWDFFFMFFTFLYFTFFGMMTVAVTPNQNVASIVAGFFYTVWNLFSGFIVPRPRIPIWWRWYYWGCPIAWTLYGLVASQFGDLQDPLTDQNQTVEQFLRSNFGFKHDFLGVVAAVIVAFAVVFAFTFALGIKAFNFQRR 1436          
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: PDR2_ORYSJ (Probable pleiotropic drug resistance protein 2 OS=Oryza sativa subsp. japonica GN=PDR2 PE=3 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 4.210e-66
Identity = 125/234 (53.42%), Postives = 153/234 (65.38%), Query Frame = 2
Query:    2 DLGGRTKRNQDLFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDDKKMDTGETVKQFLKDYFDFKHDXXXXXXXXXXXXXXXXXXXXXXXIKMFNFQKR 703
            DLGG+T ++QDLFNAMG M++AVLF+GV    SVQP+VSVERTVFYRE+AAGMY+  P+A  QV IE PY LVQS++YG IVY+MIGF+WTAAKFFWY+               MAV LTP++H+A+IVS+ FYG+WN+FSGF+            Y W  P+AWTLYGLVASQFGD+    MD G  VK F+++YFDFKH                        I   NFQKR
Sbjct: 1232 DLGGKTGKSQDLFNAMGSMYSAVLFIGVLNSQSVQPVVSVERTVFYRERAAGMYSAFPYAFGQVAIEFPYTLVQSIIYGIIVYSMIGFKWTAAKFFWYLFFMFFTFLYFTFYGMMAVGLTPSYHVASIVSSAFYGIWNLFSGFIIPRPKVPIWWRWYCWICPVAWTLYGLVASQFGDI-MTPMDDGTPVKIFVENYFDFKHSWLGVVAVVIVAFTMLFAFLFGFAIMKLNFQKR 1464          
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: TUR2_SPIPO (Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrrhiza GN=TUR2 PE=1 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 2.554e-63
Identity = 117/234 (50.00%), Postives = 148/234 (63.25%), Query Frame = 2
Query:    2 DLGGRTKRNQDLFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDDKKMDTGETVKQFLKDYFDFKHDXXXXXXXXXXXXXXXXXXXXXXXIKMFNFQKR 703
            DLG +   + DL NAMG M+ AVLF+G+Q   +VQPIV VERTVFYREKAAGMY+ +P+A AQV+IE+P+ILVQ+++YG +VY+MIGF+WTAAKF WY+               MAVA+TPN  IAAIV+  FY +WN+F+GF+            YYWA P+AWTLYGLV SQFG+  D   D  ETVK FL+ +  F+HD                       IK  NFQ+R
Sbjct: 1208 DLGKKRSTSLDLINAMGSMYAAVLFIGIQNAQTVQPIVDVERTVFYREKAAGMYSALPYAYAQVLIEVPHILVQTLLYGLLVYSMIGFDWTAAKFLWYMFFMFFTFLYFTYYGMMAVAMTPNSDIAAIVAAAFYAIWNIFAGFIIPRPRIPIWWRWYYWACPVAWTLYGLVVSQFGEYTDTMSDVDETVKDFLRRFLGFRHDFLPVVGVMVVVFTVLFASIFAFSIKTLNFQRR 1441          
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: PDR7_ORYSJ (Putative pleiotropic drug resistance protein 7 OS=Oryza sativa subsp. japonica GN=PDR7 PE=3 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 5.690e-63
Identity = 115/234 (49.15%), Postives = 153/234 (65.38%), Query Frame = 2
Query:    2 DLGGRTKRNQDLFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDDKKMDTGETVKQFLKDYFDFKHDXXXXXXXXXXXXXXXXXXXXXXXIKMFNFQKR 703
            +LG +  +  DLFN++G M+ AVLF+G+Q   +VQPIV VERTVFYREKAAGMY+ +P+A AQV+IEIP+I +Q+VVYG IVY++IGF+WT  KFFWY+               MAVA+TPN  IAAIVST FY +WN+F+GF+            Y WA P+AWTLYGLVASQ+GD+ +  ++ GE V+ +++ YF F+HD                       IK+FNFQ+R
Sbjct: 1211 NLGKKINKRLDLFNSLGSMYAAVLFIGIQNGQTVQPIVDVERTVFYREKAAGMYSALPYAFAQVLIEIPHIFLQTVVYGLIVYSLIGFDWTVEKFFWYMFFMFFTFMYFTFYGMMAVAMTPNSDIAAIVSTAFYCIWNIFAGFLIPRPRIPIWWRWYSWACPVAWTLYGLVASQYGDITNSTLEDGEVVQDYIRRYFGFRHDYLGYVATAVVGFAALFAFVFAFSIKVFNFQRR 1444          
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: PDR4_ORYSJ (Pleiotropic drug resistance protein 4 OS=Oryza sativa subsp. japonica GN=PDR4 PE=2 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 6.291e-62
Identity = 117/234 (50.00%), Postives = 145/234 (61.97%), Query Frame = 2
Query:    2 DLGGRTKRNQDLFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDDKKMDTGETVKQFLKDYFDFKHDXXXXXXXXXXXXXXXXXXXXXXXIKMFNFQKR 703
            +LG RTK+ QDLFNAMG M+ AVL++GVQ   SVQP+V VERTVFYRE+AAGMY+  P+A  QV IE+PYI+VQ+++YG +VY+MIGFEWT AKF WY+               MAV LTPN  IAAI+S+ FY +WN+FSG++            Y W  P+AWTLYGLVASQFGD+         TV QF+ DYF F H+                       I  FNFQ+R
Sbjct: 1217 NLGTRTKKQQDLFNAMGSMYAAVLYIGVQNSGSVQPVVVVERTVFYRERAAGMYSAFPYAFGQVAIELPYIMVQTLIYGVLVYSMIGFEWTVAKFLWYLFFMYFTLLYFTFYGMMAVGLTPNESIAAIISSAFYNVWNLFSGYLIPRPKIPVWWRWYCWICPVAWTLYGLVASQFGDIQHVLEGDTRTVAQFVTDYFGFHHNFLWVVAVVHVVFAVTFAFLFSFAIMKFNFQRR 1450          
BLAST of FC931429 vs. ExPASy Swiss-Prot
Match: PDR1_ORYSJ (Probable pleiotropic drug resistance protein 1 OS=Oryza sativa subsp. japonica GN=PDR1 PE=3 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 1.073e-61
Identity = 118/234 (50.43%), Postives = 147/234 (62.82%), Query Frame = 2
Query:    2 DLGGRTKRNQDLFNAMGPMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFVXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDDKKMDTGETVKQFLKDYFDFKHDXXXXXXXXXXXXXXXXXXXXXXXIKMFNFQKR 703
            DLGG+  ++QDLFNAMG M+ AVLF+GV    SVQP+VSVERTVFYRE+AAGMY+ +P+A  QV IE PY LVQSV+Y  IVY+MIGF+WT AKFFWY+               MAV LTP++H+A+IVS+ FY +WN+F+GFV            Y W  P+AWTLYGL+ SQ+GD+    MD G  V  F+++YFDFKH                        I   NFQKR
Sbjct: 1236 DLGGKMGQSQDLFNAMGSMYAAVLFIGVLNGQSVQPVVSVERTVFYRERAAGMYSALPYAFGQVAIEFPYTLVQSVIYSIIVYSMIGFQWTVAKFFWYLFFMFFTLLYFTFYGMMAVGLTPSYHVASIVSSAFYAIWNLFTGFVISRPATPVWWRWYCWICPVAWTLYGLIVSQYGDI-VTPMDDGIPVNVFVENYFDFKHSWLGFVAVVIVAFTMLFAFLFGFAIMKLNFQKR 1468          
The following BLAST results are available for this feature:
BLAST of FC931429 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 34
Match NameE-valueIdentityDescription
AB40G_ARATH1.652e-7053.85ABC transporter G family member 40 OS=Arabidopsis ... [more]
PDR1_TOBAC6.939e-6955.13Pleiotropic drug resistance protein 1 OS=Nicotiana... [more]
PDR3_ORYSJ5.874e-6854.70Pleiotropic drug resistance protein 3 OS=Oryza sat... [more]
PDR3_ORYSI5.874e-6854.70Pleiotropic drug resistance protein 3 OS=Oryza sat... [more]
PDR1_NICPL5.874e-6855.13Pleiotropic drug resistance protein 1 OS=Nicotiana... [more]
PDR2_ORYSJ4.210e-6653.42Probable pleiotropic drug resistance protein 2 OS=... [more]
TUR2_SPIPO2.554e-6350.00Pleiotropic drug resistance protein TUR2 OS=Spirod... [more]
PDR7_ORYSJ5.690e-6349.15Putative pleiotropic drug resistance protein 7 OS=... [more]
PDR4_ORYSJ6.291e-6250.00Pleiotropic drug resistance protein 4 OS=Oryza sat... [more]
PDR1_ORYSJ1.073e-6150.43Probable pleiotropic drug resistance protein 1 OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34105A06EF PostHarvP1 Citrus clementina cDNA clone C34105A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931429 ID=FC931429|Name=FC931429|organism=Citrus clementina|type=EST|length=713bp
GGACCTGGGTGGTAGAACGAAAAGGAACCAAGATCTTTTCAATGCAATGG
GTCCCATGTTTACTGCAGTTCTCTTCCTTGGTGTTCAATATTGTTCGTCA
GTGCAGCCAATAGTATCAGTTGAAAGGACAGTCTTTTACAGGGAAAAAGC
TGCCGGCATGTATGCAGGCATACCATGGGCATTAGCACAAGTTATGATTG
AGATTCCTTATATATTAGTTCAGTCAGTAGTGTATGGTGCTATAGTCTAT
GCTATGATTGGATTTGAATGGACAGCCGCCAAGTTTTTTTGGTATATATT
CTTCATGTACTTCACATTATTGTTCTTCACCTTCTATGGCATGATGGCTG
TGGCTTTGACACCAAACCACCACATCGCTGCCATTGTTTCAACTTTATTT
TATGGATTGTGGAACGTCTTTTCTGGGTTTGTTATCCCAAGACCTAGGAT
TCCAATATGGTGGAGATGGTACTATTGGGCCAACCCCATAGCTTGGACCT
TGTATGGACTGGTTGCTTCGCAGTTCGGAGATATGGACGACAAGAAAATG
GATACTGGTGAAACGGTGAAACAGTTTCTTAAGGACTATTTTGATTTCAA
ACATGATTTTCTGGGAGTAGTTGCAGCTGTTCTCGTTGTCTTTGCAGTGT
TATTTGGATTTCTCTTCGCCCTAGGAATTAAGATGTTTAACTTCCAGAAG
CGGTAGTAATTCT
back to top