FC931430

Overview
NameFC931430
Unique NameFC931430
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length719
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15324 contig Ccv1_Contig15324:1..719. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931430 vs. ExPASy Swiss-Prot
Match: NCS1_COPJA (S-norcoclaurine synthase 1 OS=Coptis japonica GN=NCS1 PE=1 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 3.656e-33
Identity = 74/189 (39.15%), Postives = 113/189 (59.79%), Query Frame = 3
Query:  105 IDDVQELRKVEPSTIPERFVRDLTERPSSLATALSPPGGIPIINLSKLMKGNHDEFHNEILNLATACEEWGFFQVIDHGIELNLLENIEKVAKDFFMLPLEEKKKYPMLPGTVQGYGQAFVFSENQKLDWCNMFALGVEPHFIRNPKLWPAKPAEFSETLETYSRDVRKLCQCLLKYVAISLGLKEKLL 671
            +++VQ L   E   +P R+VR   E    +    S    IP+I+LS+L+   +    +E+    +AC +WGFFQ+I+HG+   ++E ++   +DFF LP +EK  Y  LP  ++GYGQAFV SE QKLDW +M  L  +P   RN + WP  P  F ET+E YS +++K+  CL   +A +LGL+ ++L
Sbjct:   14 VENVQVLAGKELKNLPNRYVRPELEHDDVVPIDNSLE--IPVIDLSRLLDQQYA--CDELAKFHSACLDWGFFQLINHGVREEVIEKMKVDTEDFFRLPFKEKNAYRQLPNGMEGYGQAFVTSEEQKLDWADMHFLITKPVQERNMRFWPTSPTSFRETMEKYSMELQKVAMCLTGMMAKNLGLESEIL 198          
BLAST of FC931430 vs. ExPASy Swiss-Prot
Match: SRG1_ARATH (Protein SRG1 OS=Arabidopsis thaliana GN=SRG1 PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 2.369e-32
Identity = 75/197 (38.07%), Postives = 121/197 (61.42%), Query Frame = 3
Query:  105 IDDVQELRKVEP-STIPERFVR---DLTERPSSLATALSPPGGIPIINLSKLMKGNHDEFHNEILNLATACEEWGFFQVIDHGIELNLLENIEKVAKDFFMLPLEEKKKYPMLPGTVQGYGQAFVFSENQKLDWCNMFALGVEPHFIRNPKLWPAKPAEFSETLETYSRDVRKLCQCLLKYVAISLGLKEKLLKNVW 683
            +  VQE+ K +  +T+P R+VR   D TE        +     IPII++ +L         +E+  L  AC+EWGFFQ+++HGI+ + L+ ++   +DFF LP+EEKKK+   P  ++G+GQAFV SE+QKLDW ++F   V+P  +R P L+P  P  F +TLE YS +V+ + + L+  +A +L +K + L+ ++
Sbjct:   14 VPSVQEMVKEKTITTVPPRYVRSDQDKTEVDDDFDVKIE----IPIIDMKRLCSST--TMDSEVEKLDFACKEWGFFQLVNHGIDSSFLDKVKSEIQDFFNLPMEEKKKFWQRPDEIEGFGQAFVVSEDQKLDWADLFFHTVQPVELRKPHLFPKLPLPFRDTLEMYSSEVQSVAKILIAKMARALEIKPEELEKLF 204          
BLAST of FC931430 vs. ExPASy Swiss-Prot
Match: FL3H_PETCR (Flavanone 3-dioxygenase OS=Petroselinum crispum GN=FHT PE=1 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.761e-19
Identity = 58/181 (32.04%), Postives = 92/181 (50.83%), Query Frame = 3
Query:  135 EPSTIPERFVRDLTERPSSLATALSPPGGIPIINLSKLMKGNHDEFHNEILNLATACEEWGFFQVIDHGIELNLLENIEKVAKDFFMLPLEEKKKYPMLPGTVQGYGQAFVFSENQKLDWCNMFALGVEPHFIRNPKLWPAKPAEFSETLETYSRDVRKLCQCLLKYVAISLGL-KEKLLK 674
            +  T+  +FVRD  ERP       S    IP+I+L+ +   + D+       +  ACE+WG FQV+DHGI+++L+  + ++A+ FF LP EEK ++ M  G   G+  +         DW  +      P   R+   WP KP  +    E YS ++  L   LL+ ++ ++GL KE L K
Sbjct:   11 QEKTLNSKFVRDEDERPKIAYNKFSDE--IPVISLAGIDDDSVDKRSQICRKIVEACEDWGIFQVVDHGIDIDLISEMTRLARQFFALPAEEKLRFDMTGGKKGGFIVSSHLQGEAVQDWREIVTYFSYPIQARDYSRWPDKPEGWRSITEMYSDELMALACKLLEVLSEAMGLEKEGLTK 189          
BLAST of FC931430 vs. ExPASy Swiss-Prot
Match: LDOX_PERFR (Leucoanthocyanidin dioxygenase OS=Perilla frutescens GN=ANS PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.300e-19
Identity = 63/208 (30.29%), Postives = 104/208 (50.00%), Query Frame = 3
Query:   96 VGQIDDVQELRKVEPSTIPERFVRDLTERPSSLATALSPPGG-----IPIINLSKLMKGNHD---EFHNEILNLATACEEWGFFQVIDHGIELNLLENIEKVAKDFFMLPLEEKKKYP--MLPGTVQGYGQAFVFSENQKLDWCNMFALGVEPHFIRNPKLWPAKPAEFSETLETYSRDVRKLCQCLLKYVAISLGL-KEKLLKNVWG 686
            +G    V+EL +    TIP+ +VR   E  S +   L+         +P I+L ++   + +   + H E+   AT   +WG   +I+HGI   L++ ++   K+FF LP+EEK+ Y      G VQGYG     + + +L+W + F   V P    +  +WP KP ++      Y++ +R L   +L  ++I LGL K +L K V G
Sbjct:    6 MGPSPRVEELARSGLDTIPKDYVRPEEELKSIIGNILAEEKSSEGPQLPTIDLEEMDSRDEEGRKKCHEELKKAAT---DWGVMHLINHGIPEELIDRVKAAGKEFFELPVEEKEAYANDQAAGNVQGYGSKLANNASGQLEWEDYFFHCVYPEHKTDLSIWPTKPPDYIPATSEYAKQLRALATKILSVLSIGLGLEKGRLEKEVGG 210          
BLAST of FC931430 vs. ExPASy Swiss-Prot
Match: FL3H_MATIN (Naringenin,2-oxoglutarate 3-dioxygenase (Fragment) OS=Matthiola incana GN=FHT PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 3.004e-19
Identity = 59/181 (32.60%), Postives = 95/181 (52.49%), Query Frame = 3
Query:  141 STIPERFVRDLTERPSSLATALSPPGGIPIINLSKL--MKGNHDEFHNEILNLATACEEWGFFQVIDHGIELNLLENIEKVAKDFFMLPLEEKKKYPMLPGTVQGYGQAFVFSENQKLDWCNMFALGVEPHFIRNPKLWPAKPAEFSETLETYSRDVRKLCQCLLKYVAISLGLKEKLLKN 677
            S +  +FVRD  ERP       S    IP+I+L+ +  + G   E   EI+    ACE WG FQV+DHG++ +L+ ++ ++A+DFF LP EEK ++ M  G   G+  +         DW  +      P   R+   WP KP  +++  E YS  +  L   LL+ ++ ++GL+++ L N
Sbjct:   12 SKLNSKFVRDEDERPKVAYNEFSDE--IPVISLAGIDDVDGKRGEICREIVE---ACENWGIFQVVDHGVDTSLVADMTRLARDFFALPPEEKLRFDMSGGKKGGFIVSSHLQGEAVQDWREIVTYFSYPVRNRDYSRWPDKPQGWAKVTEEYSEKLMGLACKLLEVLSEAMGLEKESLTN 187          
BLAST of FC931430 vs. ExPASy Swiss-Prot
Match: FL3H_CALCH (Naringenin,2-oxoglutarate 3-dioxygenase OS=Callistephus chinensis GN=FHT PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 5.125e-19
Identity = 60/183 (32.79%), Postives = 94/183 (51.37%), Query Frame = 3
Query:  123 LRKVEPSTIPERFVRDLTERPSSLATALSPPGGIPIINLSKLMKGNHDEFHNEILNLATACEEWGFFQVIDHGIELNLLENIEKVAKDFFMLPLEEKKKYPMLPGTVQGYGQAFVFSENQKLDWCNMFALGVEPHFIRNPKLWPAKPAEFSETLETYSRDVRKLCQCLLKYVAISLGLKEKLL 671
            L+  E S    +FVRD  ERP       S    IP+I+L+ +      E  +EI+    ACE+WG FQV+DHG++  LL ++  +A+DFF LP +EK ++ M  G   G+  +         DW  +      P   R+   WP KP E+    E YS+ +  L   LL+ ++ ++GL+++ L
Sbjct:    7 LKWEEHSLHENKFVRDEDERPKVPYNTFS--NEIPVISLAGIDGCRRAEICDEIVK---ACEDWGIFQVVDHGVDTKLLSDMTGLARDFFHLPTQEKLRFDMTGGKKGGFIVSSHLQGEAVQDWREIVTYFSYPIKARDYSRWPDKPNEWRAVTEEYSKVLMGLACKLLEVLSEAMGLEKEAL 184          
BLAST of FC931430 vs. ExPASy Swiss-Prot
Match: FL3H_ARATH (Naringenin,2-oxoglutarate 3-dioxygenase OS=Arabidopsis thaliana GN=F3H PE=1 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 5.125e-19
Identity = 58/181 (32.04%), Postives = 94/181 (51.93%), Query Frame = 3
Query:  141 STIPERFVRDLTERPSSLATALSPPGGIPIINLSKL--MKGNHDEFHNEILNLATACEEWGFFQVIDHGIELNLLENIEKVAKDFFMLPLEEKKKYPMLPGTVQGYGQAFVFSENQKLDWCNMFALGVEPHFIRNPKLWPAKPAEFSETLETYSRDVRKLCQCLLKYVAISLGLKEKLLKN 677
            S +  +FVRD  ERP       S    IP+I+L+ +  + G   E   +I+    ACE WG FQV+DHG++ NL+ ++ ++A+DFF LP E+K ++ M  G   G+  +         DW  +      P   R+   WP KP  + +  E YS  +  L   LL+ ++ ++GL+++ L N
Sbjct:   13 SKLNSKFVRDEDERPKVAYNVFSDE--IPVISLAGIDDVDGKRGEICRQIVE---ACENWGIFQVVDHGVDTNLVADMTRLARDFFALPPEDKLRFDMSGGKKGGFIVSSHLQGEAVQDWREIVTYFSYPVRNRDYSRWPDKPEGWVKVTEEYSERLMSLACKLLEVLSEAMGLEKESLTN 188          
BLAST of FC931430 vs. ExPASy Swiss-Prot
Match: FNSI_PETCR (Flavone synthase OS=Petroselinum crispum GN=FNSI PE=1 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 6.693e-19
Identity = 55/168 (32.74%), Postives = 84/168 (50.00%), Query Frame = 3
Query:  159 FVRDLTERPSSLATALSPPGGIPIINLSKLMKGNHDEFHNEILNLATACEEWGFFQVIDHGIELNLLENIEKVAKDFFMLPLEEKKKYPMLPGTVQGYGQAFVFSENQKLDWCNMFALGVEPHFIRNPKLWPAKPAEFSETLETYSRDVRKLCQCLLKYVAISLGLKE 662
            FVRD  ERP       S    IPII+L+ L   +          +  ACE+WG FQV+DHGI+  L+  + +++++FF LP EEK +Y    G   G+  + V   +  +DW         P   R+   WP KP  +  T E YS  +  L   LL+ ++ ++GL++
Sbjct:   19 FVRDEDERPKVAYNQFS--NEIPIISLAGLDDDSDGRRPEICRKIVKACEDWGIFQVVDHGIDSGLISEMTRLSREFFALPAEEKLEYDTTGGKRGGFTISTVLQGDDAMDWREFVTYFSYPINARDYSRWPKKPEGWRSTTEVYSEKLMVLGAKLLEVLSEAMGLEK 184          
BLAST of FC931430 vs. ExPASy Swiss-Prot
Match: FLS_CITUN (Flavonol synthase/flavanone 3-hydroxylase OS=Citrus unshiu GN=FLS PE=1 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 6.693e-19
Identity = 63/199 (31.66%), Postives = 98/199 (49.25%), Query Frame = 3
Query:  102 QIDDVQELRKVEPS--TIPERFVRDLTERPSSLATALSPPGGIPIINLSKLMKGNHDEFHNEILNLATACEEWGFFQVIDHGIELNLLENIEKVAKDFFMLPLEEKKKY--PMLPGTVQGYGQAFVFSENQKLDWCNMFALGVEPHFIRNPKLWPAKPAEFSETLETYSRDVRKLCQCLLKYVAISLGLKEKLLKNVWG 686
            +++ VQ +  +  S  TIP  F+R   E+P+S  T   P   IP I+L   ++         + ++A A  EWG FQV +HGI  +L+  ++ V K+FF LP EEK+ Y  P     VQGYG         K  W +     V P    N + WP  P  +    E Y++ +R++   L  Y+++ LG++  +LK   G
Sbjct:    2 EVERVQAIASLSHSNGTIPAEFIRPEKEQPAS-TTYHGPAPEIPTIDLDDPVQDRL------VRSIAEASREWGIFQVTNHGIPSDLICKLQAVGKEFFELPQEEKEVYSRPADAKDVQGYGTKLQKEVEGKKSWVDHLFHRVWPPSSINYRFWPKNPPSYRAVNEEYAKYMREVVDKLFTYLSLGLGVEGGVLKEAAG 193          
BLAST of FC931430 vs. ExPASy Swiss-Prot
Match: LDOX_MALDO (Leucoanthocyanidin dioxygenase OS=Malus domestica GN=ANS PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.491e-18
Identity = 58/194 (29.90%), Postives = 98/194 (50.52%), Query Frame = 3
Query:  141 STIPERFVR---------DLTERPSSLATALSPPGGIPIINLSKLMKGNHDEFHNEILNLATACEEWGFFQVIDHGIELNLLENIEKVAKDFFMLPLEEKKKYP--MLPGTVQGYGQAFVFSENQKLDWCNMFALGVEPHFIRNPKLWPAKPAEFSETLETYSRDVRKLCQCLLKYVAISLGLKE-KLLKNVWG 686
            STIP+ ++R         D+ E+  +     +    +P I+L ++   N          L  A  +WG   +++HGI   L++ + K  K FF LP+E+K+KY      G +QGYG     + + +L+W + F   V P   R+  +WP  PA++ E    Y++ +R+L   +LK +++ LGL E +L K V G
Sbjct:   20 STIPKEYIRPKDELVNIGDIFEQEKN-----NEGPQVPTIDLKEIESDNEKVRAKCREKLKKAAVDWGVMHLVNHGISDELMDKVRKAGKAFFDLPIEQKEKYANDQASGKIQGYGSKLANNASGQLEWEDYFFHCVYPEDKRDLSIWPQTPADYIEATAEYAKQLRELATKVLKVLSLGLGLDEGRLEKEVGG 208          
The following BLAST results are available for this feature:
BLAST of FC931430 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 43
Match NameE-valueIdentityDescription
NCS1_COPJA3.656e-3339.15S-norcoclaurine synthase 1 OS=Coptis japonica GN=N... [more]
SRG1_ARATH2.369e-3238.07Protein SRG1 OS=Arabidopsis thaliana GN=SRG1 PE=2 ... [more]
FL3H_PETCR1.761e-1932.04Flavanone 3-dioxygenase OS=Petroselinum crispum GN... [more]
LDOX_PERFR2.300e-1930.29Leucoanthocyanidin dioxygenase OS=Perilla frutesce... [more]
FL3H_MATIN3.004e-1932.60Naringenin,2-oxoglutarate 3-dioxygenase (Fragment)... [more]
FL3H_CALCH5.125e-1932.79Naringenin,2-oxoglutarate 3-dioxygenase OS=Callist... [more]
FL3H_ARATH5.125e-1932.04Naringenin,2-oxoglutarate 3-dioxygenase OS=Arabido... [more]
FNSI_PETCR6.693e-1932.74Flavone synthase OS=Petroselinum crispum GN=FNSI P... [more]
FLS_CITUN6.693e-1931.66Flavonol synthase/flavanone 3-hydroxylase OS=Citru... [more]
LDOX_MALDO1.491e-1829.90Leucoanthocyanidin dioxygenase OS=Malus domestica ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34105A07EF PostHarvP1 Citrus clementina cDNA clone C34105A07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931430 ID=FC931430|Name=FC931430|organism=Citrus clementina|type=EST|length=719bp
GAAGTAAAGCTTCATATATTTTTCTTTAGTTGCAGTTAGATTATCGCTTC
AAAAACTCTGTTTCCATGGCTCCAGTACCAACTTTTCCCGTCAAAGTTGG
TCAAATAGATGATGTTCAAGAGCTGAGAAAAGTCGAACCTAGCACAATTC
CTGAAAGATTTGTTAGAGACTTGACTGAAAGGCCATCGTCACTGGCTACA
GCTCTTTCTCCACCTGGTGGCATTCCCATCATCAACCTCTCAAAACTCAT
GAAGGGCAACCACGATGAATTTCACAATGAAATTTTAAACCTCGCAACTG
CCTGCGAAGAGTGGGGATTCTTTCAGGTGATTGACCATGGGATTGAACTG
AACTTACTCGAGAACATAGAGAAGGTGGCCAAAGATTTTTTCATGCTACC
TTTAGAAGAGAAAAAGAAGTACCCCATGCTACCAGGGACAGTTCAAGGAT
ATGGGCAAGCTTTTGTGTTCTCGGAGAACCAAAAACTTGATTGGTGCAAC
ATGTTTGCCCTTGGTGTCGAGCCTCACTTTATCAGGAACCCAAAACTCTG
GCCAGCAAAGCCAGCTGAGTTCAGTGAAACTCTAGAGACTTACTCAAGAG
ATGTGAGAAAACTTTGCCAGTGTCTGCTCAAGTACGTAGCAATAAGCCTT
GGCTTGAAAGAGAAACTTTTGAAGAATGTTTGGGGTTGCTGTGCAGGCTG
TGAGGATGACTACTACCAC
back to top