FC931441

Overview
NameFC931441
Unique NameFC931441
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length741
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13004 contig Ccv1_Contig13004:43..783. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931441 vs. ExPASy Swiss-Prot
Match: DLDH1_ARATH (Dihydrolipoyl dehydrogenase 1, mitochondrial OS=Arabidopsis thaliana GN=LPD1 PE=1 SV=2)

HSP 1 Score: 353.599 bits (906), Expect = 6.512e-97
Identity = 182/234 (77.78%), Postives = 202/234 (86.32%), Query Frame = 1
Query:   40 MVMASLARRKAYVXXXXXXXXXXXXVFKYSFSLTRGFASA-SDENDXXXXXXXXXXXXAAIKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAMHSFASHGVKFSSVEVDLPAMMAQKDKAVSNLTRGIEGLFKKNKVTYVKGYGEFISPSEVSVDTIEGGNTVVKGKNIIIATGSDVKSLPGITIDEKRIVSSTGALALNEVPKKLVVIGAGYIGLEMGSVW 738
            M MASLARRKAY             + ++SFSL+RGFAS+ SDEND            AAIKA+QLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEA HSFA+HG+K SSVEVDLPAM+AQKD AV NLTRGIEGLFKKNKVTYVKGYG+FISP+EVSV+TI+GGNT+VKGK+II+ATGSDVKSLPGITIDEK+IVSSTGAL+L+EVPKKL+VIGAGYIGLEMGSVW
Sbjct:    1 MAMASLARRKAYFLTRNLSNSPTDAL-RFSFSLSRGFASSGSDENDVVIIGGGPGGYVAAIKASQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAKHSFANHGIKVSSVEVDLPAMLAQKDNAVKNLTRGIEGLFKKNKVTYVKGYGKFISPNEVSVETIDGGNTIVKGKHIIVATGSDVKSLPGITIDEKKIVSSTGALSLSEVPKKLIVIGAGYIGLEMGSVW 233          
BLAST of FC931441 vs. ExPASy Swiss-Prot
Match: DLDH_PEA (Dihydrolipoyl dehydrogenase, mitochondrial OS=Pisum sativum GN=LPD PE=1 SV=2)

HSP 1 Score: 349.747 bits (896), Expect = 9.404e-96
Identity = 182/234 (77.78%), Postives = 196/234 (83.76%), Query Frame = 1
Query:   40 MVMASLARRKAYVXXXXXXXXXXXXVFKYSFSL-TRGFASASDENDXXXXXXXXXXXXAAIKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAMHSFASHGVKFSSVEVDLPAMMAQKDKAVSNLTRGIEGLFKKNKVTYVKGYGEFISPSEVSVDTIEGGNTVVKGKNIIIATGSDVKSLPGITIDEKRIVSSTGALALNEVPKKLVVIGAGYIGLEMGSVW 738
            M MA+LARRK Y               +YSFSL +R FAS SDEND            AAIKAAQLG KTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEA HSFA+HGVK S+VE+DL AMM QKDKAVSNLTRGIEGLFKKNKVTYVKGYG+F+SPSE+SVDTIEG NTVVKGK+IIIATGSDVKSLPG+TIDEK+IVSSTGALAL+E+PKKLVVIGAGYIGLEMGSVW
Sbjct:    1 MAMANLARRKGY-------SLLSSETLRYSFSLRSRAFASGSDENDVVIIGGGPGGYVAAIKAAQLGFKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAKHSFANHGVKVSNVEIDLAAMMGQKDKAVSNLTRGIEGLFKKNKVTYVKGYGKFVSPSEISVDTIEGENTVVKGKHIIIATGSDVKSLPGVTIDEKKIVSSTGALALSEIPKKLVVIGAGYIGLEMGSVW 227          
BLAST of FC931441 vs. ExPASy Swiss-Prot
Match: DLDH2_ARATH (Dihydrolipoyl dehydrogenase 2, mitochondrial OS=Arabidopsis thaliana GN=LPD2 PE=1 SV=1)

HSP 1 Score: 349.362 bits (895), Expect = 1.228e-95
Identity = 181/234 (77.35%), Postives = 197/234 (84.19%), Query Frame = 1
Query:   40 MVMASLARRKAYVXXXXXXXXXXXXVFKYSFSLTRGFASA-SDENDXXXXXXXXXXXXAAIKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAMHSFASHGVKFSSVEVDLPAMMAQKDKAVSNLTRGIEGLFKKNKVTYVKGYGEFISPSEVSVDTIEGGNTVVKGKNIIIATGSDVKSLPGITIDEKRIVSSTGALALNEVPKKLVVIGAGYIGLEMGSVW 738
            M MASLARRKAY              F++SFSLTRGFAS+ SD+ND            AAIKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEA H FA+HGVK SSVEVDLPAM+AQKD AV NLTRG+EGLFKKNKV YVKGYG+F+SPSEVSVDTI+G N VVKGK+II+ATGSDVKSLPGITIDEK+IVSSTGAL+L E+PKKL+VIGAGYIGLEMGSVW
Sbjct:    1 MAMASLARRKAYFLTRNISNSPTD-AFRFSFSLTRGFASSGSDDNDVVIIGGGPGGYVAAIKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAKHVFANHGVKVSSVEVDLPAMLAQKDTAVKNLTRGVEGLFKKNKVNYVKGYGKFLSPSEVSVDTIDGENVVVKGKHIIVATGSDVKSLPGITIDEKKIVSSTGALSLTEIPKKLIVIGAGYIGLEMGSVW 233          
BLAST of FC931441 vs. ExPASy Swiss-Prot
Match: DLDH_SCHPO (Dihydrolipoyl dehydrogenase, mitochondrial OS=Schizosaccharomyces pombe GN=dld1 PE=2 SV=2)

HSP 1 Score: 230.335 bits (586), Expect = 8.315e-60
Identity = 118/198 (59.60%), Postives = 140/198 (70.71%), Query Frame = 1
Query:  151 ASASDENDXXXXXXXXXXXXAAIKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAMHSFASHGVKFSSVEVDLPAMMAQKDKAVSNLTRGIEGLFKKNKVTYVKGYGEFISPSEVSVDTIEG-GNTVVKGKNIIIATGSDVKSLPGITIDEKRIVSSTGALALNEVPKKLVVIGAGYIGLEMGSVWA 741
            AS + E D            AAI+ AQLGLKT C+EKRG LGGTCLNVGCIPSKALL++SH+YH   H     G+  S V V+L  MM  KD +V +LT GIE LFKKNKV Y KG G FI P  +SV  I+G  +  +K KN IIATGS+VK  PG+TIDEK+IVSSTGAL+L+EVPKK+ V+G G IGLEMGSVW+
Sbjct:   40 ASGNGEYDLCVIGGGPGGYVAAIRGAQLGLKTICVEKRGTLGGTCLNVGCIPSKALLNNSHIYHTVKHDTKRRGIDVSGVSVNLSQMMKAKDDSVKSLTSGIEYLFKKNKVEYAKGTGSFIDPQTLSVKGIDGAADQTIKAKNFIIATGSEVKPFPGVTIDEKKIVSSTGALSLSEVPKKMTVLGGGIIGLEMGSVWS 237          
BLAST of FC931441 vs. ExPASy Swiss-Prot
Match: DLDH_DICDI (Dihydrolipoyl dehydrogenase, mitochondrial OS=Dictyostelium discoideum GN=lpd PE=3 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 5.390e-59
Identity = 113/177 (63.84%), Postives = 136/177 (76.84%), Query Frame = 1
Query:  211 AAIKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAMHSFASHGVKFSSVEVDLPAMMAQKDKAVSNLTRGIEGLFKKNKVTYVKGYGEFISPSEVSVDTIEGGNTVVKGKNIIIATGSDVKSLPGITIDEKRIVSSTGALALNEVPKKLVVIGAGYIGLEMGSVWA 741
            A IKA QLG+K T +EKRG LGGTCLNVGCIPSKALL++SH+Y EA    + +GVK S VE+DL AMM  KDK+VS LT GIEGLFKKNKV Y KG+G+   P+ V V   +G    ++ KNI+IATGS+V SLP + IDE+ I+SSTGALAL  VPKKL+VIG G IGLE+GSVW+
Sbjct:   37 AGIKAGQLGMKVTVVEKRGKLGGTCLNVGCIPSKALLNASHLYEEATTKMSKYGVKCSGVELDLGAMMQYKDKSVSGLTSGIEGLFKKNKVKYDKGFGKITGPNTVEVTLNDGSVKTIETKNIVIATGSEVTSLPNVNIDEESIISSTGALALKSVPKKLIVIGGGVIGLELGSVWS 213          
BLAST of FC931441 vs. ExPASy Swiss-Prot
Match: DLDH_TRYBB (Dihydrolipoyl dehydrogenase OS=Trypanosoma brucei brucei PE=3 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 5.577e-56
Identity = 108/178 (60.67%), Postives = 139/178 (78.09%), Query Frame = 1
Query:  211 AAIKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAMHSFASHGVKFSS-VEVDLPAMMAQKDKAVSNLTRGIEGLFKKNKVTYVKGYGEFISPSEVSVDTIEGGNTVVKGKNIIIATGSDVKSLPGITIDEKRIVSSTGALALNEVPKKLVVIGAGYIGLEMGSVWA 741
            AAIKAAQLGLKT C+EKRGALGGTCLNVGCIPSKALLH++HMYH+A  +F  +G+   + V +D+  M  QK+K+V+ LT G+E L KKNKVTY KG   F++P+ ++V  I+G +  ++ KN IIATGS+  +LP +  DEK ++SSTGALAL +VPKK+VVIG G IGLE+GSVWA
Sbjct:   26 AAIKAAQLGLKTACVEKRGALGGTCLNVGCIPSKALLHATHMYHDAHANFERYGLMGGAGVTMDVAKMQQQKEKSVNGLTSGVEYLLKKNKVTYYKGEAGFVTPNTLNVKGIDGKDEAIEAKNTIIATGSEPTALPFLPFDEKVVLSSTGALALQQVPKKMVVIGGGVIGLELGSVWA 203          
BLAST of FC931441 vs. ExPASy Swiss-Prot
Match: DLDH_MACFA (Dihydrolipoyl dehydrogenase, mitochondrial OS=Macaca fascicularis GN=DLD PE=2 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 1.794e-54
Identity = 109/177 (61.58%), Postives = 132/177 (74.58%), Query Frame = 1
Query:  211 AAIKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAM-HSFASHGVKFSSVEVDLPAMMAQKDKAVSNLTRGIEGLFKKNKVTYVKGYGEFISPSEVSVDTIEGGNTVVKGKNIIIATGSDVKSLPGITIDEKRIVSSTGALALNEVPKKLVVIGAGYIGLEMGSVW 738
            AAIKAAQLG KT C+EK   LGGTCLNVGCIPSKALL++SH YH A    FAS G++ S V ++L  MM QK  AV  LT GI  LFK+NKV +V GYG+    ++V+   ++GG  VV  KNI+IATGS+V   PGITIDE  IVSSTGAL+L +VP+K+VVIGAG IG+E+GSVW
Sbjct:   56 AAIKAAQLGFKTVCVEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHGKDFASRGIEMSEVRLNLDKMMEQKSTAVKALTGGIAHLFKQNKVIHVNGYGKITGKNQVTATKVDGGTQVVDTKNILIATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVW 232          
BLAST of FC931441 vs. ExPASy Swiss-Prot
Match: DLDH_HUMAN (Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo sapiens GN=DLD PE=1 SV=2)

HSP 1 Score: 211.46 bits (537), Expect = 3.997e-54
Identity = 109/177 (61.58%), Postives = 131/177 (74.01%), Query Frame = 1
Query:  211 AAIKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAM-HSFASHGVKFSSVEVDLPAMMAQKDKAVSNLTRGIEGLFKKNKVTYVKGYGEFISPSEVSVDTIEGGNTVVKGKNIIIATGSDVKSLPGITIDEKRIVSSTGALALNEVPKKLVVIGAGYIGLEMGSVW 738
            AAIKAAQLG KT CIEK   LGGTCLNVGCIPSKALL++SH YH A    FAS G++ S V ++L  MM QK  AV  LT GI  LFK+NKV +V GYG+    ++V+    +GG  V+  KNI+IATGS+V   PGITIDE  IVSSTGAL+L +VP+K+VVIGAG IG+E+GSVW
Sbjct:   56 AAIKAAQLGFKTVCIEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHGKDFASRGIEMSEVRLNLDKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKITGKNQVTATKADGGTQVIDTKNILIATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVW 232          
BLAST of FC931441 vs. ExPASy Swiss-Prot
Match: DLDH_PONAB (Dihydrolipoyl dehydrogenase, mitochondrial OS=Pongo abelii GN=DLD PE=2 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 2.591e-53
Identity = 107/177 (60.45%), Postives = 130/177 (73.45%), Query Frame = 1
Query:  211 AAIKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAM-HSFASHGVKFSSVEVDLPAMMAQKDKAVSNLTRGIEGLFKKNKVTYVKGYGEFISPSEVSVDTIEGGNTVVKGKNIIIATGSDVKSLPGITIDEKRIVSSTGALALNEVPKKLVVIGAGYIGLEMGSVW 738
            AAIKAAQLG KT C+EK   LGGTCLNVGCIPSKALL++SH YH A    FAS G++ S V ++L  MM QK  AV  LT GI  LFK+NKV +V GYG+    ++V+    +GG  V+  KNI+IATGS+V   PGI IDE  IVSSTGAL+L +VP+K+VVIGAG IG+E+GSVW
Sbjct:   56 AAIKAAQLGFKTVCVEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHGKDFASRGIEMSEVRLNLDKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKITGKNQVTATKADGGTQVIDTKNILIATGSEVTPFPGIMIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVW 232          
BLAST of FC931441 vs. ExPASy Swiss-Prot
Match: DLDH_CANFA (Dihydrolipoyl dehydrogenase, mitochondrial OS=Canis familiaris GN=DLD PE=1 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 2.591e-53
Identity = 107/177 (60.45%), Postives = 130/177 (73.45%), Query Frame = 1
Query:  211 AAIKAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAM-HSFASHGVKFSSVEVDLPAMMAQKDKAVSNLTRGIEGLFKKNKVTYVKGYGEFISPSEVSVDTIEGGNTVVKGKNIIIATGSDVKSLPGITIDEKRIVSSTGALALNEVPKKLVVIGAGYIGLEMGSVW 738
            AAIKAAQLG KT C+EK   LGGTCLNVGCIPSKALL++SH YH A    FAS G++ S V ++L  MM QK  AV  LT GI  LFK+NKV +V GYG+    ++V+    +G   V+  KNI+IATGS+V   PGITIDE  IVSSTGAL+L +VP+K+VVIGAG IG+E+GSVW
Sbjct:   56 AAIKAAQLGFKTVCVEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHGKDFASRGIEMSEVRLNLEKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKITGKNQVTAKKADGSTQVIDTKNILIATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVW 232          
The following BLAST results are available for this feature:
BLAST of FC931441 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 214
Match NameE-valueIdentityDescription
DLDH1_ARATH6.512e-9777.78Dihydrolipoyl dehydrogenase 1, mitochondrial OS=Ar... [more]
DLDH_PEA9.404e-9677.78Dihydrolipoyl dehydrogenase, mitochondrial OS=Pisu... [more]
DLDH2_ARATH1.228e-9577.35Dihydrolipoyl dehydrogenase 2, mitochondrial OS=Ar... [more]
DLDH_SCHPO8.315e-6059.60Dihydrolipoyl dehydrogenase, mitochondrial OS=Schi... [more]
DLDH_DICDI5.390e-5963.84Dihydrolipoyl dehydrogenase, mitochondrial OS=Dict... [more]
DLDH_TRYBB5.577e-5660.67Dihydrolipoyl dehydrogenase OS=Trypanosoma brucei ... [more]
DLDH_MACFA1.794e-5461.58Dihydrolipoyl dehydrogenase, mitochondrial OS=Maca... [more]
DLDH_HUMAN3.997e-5461.58Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo... [more]
DLDH_PONAB2.591e-5360.45Dihydrolipoyl dehydrogenase, mitochondrial OS=Pong... [more]
DLDH_CANFA2.591e-5360.45Dihydrolipoyl dehydrogenase, mitochondrial OS=Cani... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34105B06EF PostHarvP1 Citrus clementina cDNA clone C34105B06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931441 ID=FC931441|Name=FC931441|organism=Citrus clementina|type=EST|length=741bp
GAATTCAATCGATTGATTGGAGAAAAAGTTGATTGAAAAATGGTGATGGC
AAGTCTTGCAAGAAGAAAGGCGTACGTGCTGTCAAGGAATCTCTCGAACT
CGTCGAATGGTAATGTTTTCAAGTACAGTTTCTCGCTTACAAGGGGCTTC
GCTTCGGCATCTGATGAGAACGACGTCGTCGTCATCGGAGGTGGACCTGG
TGGTTACGTGGCCGCCATCAAGGCCGCCCAGCTTGGTCTCAAGACCACGT
GCATCGAGAAGCGTGGGGCCCTCGGCGGCACGTGCCTTAACGTCGGATGC
ATCCCCTCTAAGGCACTTCTTCATTCTTCCCACATGTACCATGAAGCCAT
GCATTCTTTTGCCAGCCATGGTGTAAAGTTTTCTTCTGTTGAAGTTGATT
TGCCTGCTATGATGGCCCAAAAAGATAAAGCTGTGTCTAATCTTACAAGA
GGTATTGAAGGTCTATTCAAGAAGAACAAGGTAACCTATGTGAAAGGATA
TGGCGAGTTTATCTCCCCATCTGAGGTCTCTGTGGACACCATTGAAGGTG
GAAACACTGTCGTGAAAGGCAAGAATATCATAATTGCTACTGGTTCTGAC
GTTAAGTCTCTACCTGGGATCACCATTGATGAAAAGAGAATTGTGTCATC
CACTGGAGCTTTAGCATTGAATGAAGTTCCTAAGAAACTCGTGGTCATTG
GGGCAGGCTACATTGGGCTGGAGATGGGCTCAGTTTGGGCC
back to top