FC931458

Overview
NameFC931458
Unique NameFC931458
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length640
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC931458_ssr5 microsatellite FC931458_ssr5:5..16. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig15332 contig Ccv1_Contig15332:1..640. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK_CITLA (Cysteine synthase OS=Citrullus lanatus PE=2 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 3.733e-60
Identity = 118/131 (90.08%), Postives = 123/131 (93.89%), Query Frame = 2
Query:  248 SVIAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            S IAKDVTELIG TPLVYLNR+VDGCVAR+AAKLEMMEPCSSVKDRIGYSMI+DAE KGLI PGESVLIEPTSGNTGIGLAF+AAAKGYRLII MPASMSLERR +L AFGAELVLTDPARGMK AVQKAE
Sbjct:    6 STIAKDVTELIGNTPLVYLNRVVDGCVARVAAKLEMMEPCSSVKDRIGYSMISDAENKGLITPGESVLIEPTSGNTGIGLAFIAAAKGYRLIICMPASMSLERRTILRAFGAELVLTDPARGMKGAVQKAE 136          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK1_ORYSJ (Cysteine synthase OS=Oryza sativa subsp. japonica GN=RCS1 PE=2 SV=2)

HSP 1 Score: 221.861 bits (564), Expect = 2.265e-57
Identity = 110/129 (85.27%), Postives = 119/129 (92.25%), Query Frame = 2
Query:  254 IAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            IAKDVTELIG TPLVYLNR+ DGCV R+AAKLE MEPCSSVKDRIGYSMI DAEEKGLI PG+SVLIEPTSGNTGIGLAFMAAAKGYRL++TMPASMS+ERR++L AFGAEL+LTDP  GMK AVQKAE
Sbjct:    5 IAKDVTELIGNTPLVYLNRVTDGCVGRVAAKLESMEPCSSVKDRIGYSMITDAEEKGLITPGKSVLIEPTSGNTGIGLAFMAAAKGYRLVLTMPASMSMERRIILKAFGAELILTDPLLGMKGAVQKAE 133          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK_SPIOL (Cysteine synthase OS=Spinacia oleracea PE=1 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 5.045e-57
Identity = 111/129 (86.05%), Postives = 120/129 (93.02%), Query Frame = 2
Query:  254 IAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            IAKDVTELIGKTPLVYLN + DGCVAR+AAKLE MEPCSSVKDRIG+SMI DAE+ GLI PGESVLIEPTSGNTGIGLAF+AAAKGY+LIITMPASMSLERR +L AFGAEL+LTDPA+GMK AVQKAE
Sbjct:    8 IAKDVTELIGKTPLVYLNTVADGCVARVAAKLEGMEPCSSVKDRIGFSMITDAEKSGLITPGESVLIEPTSGNTGIGLAFIAAAKGYKLIITMPASMSLERRTILRAFGAELILTDPAKGMKGAVQKAE 136          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK_SOLTU (Cysteine synthase OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 5.045e-57
Identity = 109/129 (84.50%), Postives = 120/129 (93.02%), Query Frame = 2
Query:  254 IAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            IAKDVTELIG TPLVYLN +VDGCVAR+AAKLE MEPCSSVKDRIGYSMI DAEEKGLI+PGESVLIEPTSGNTG+GLAFMAAAKGY+LIITMP+SMSLERR++L  F +ELVLTDPA+GMK A+ KAE
Sbjct:    8 IAKDVTELIGNTPLVYLNNVVDGCVARVAAKLESMEPCSSVKDRIGYSMITDAEEKGLIKPGESVLIEPTSGNTGVGLAFMAAAKGYKLIITMPSSMSLERRIILRGFRSELVLTDPAKGMKGAISKAE 136          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK1_BRAJU (Cysteine synthase OS=Brassica juncea PE=2 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 6.589e-57
Identity = 108/131 (82.44%), Postives = 122/131 (93.13%), Query Frame = 2
Query:  248 SVIAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            S IAKDVTELIG TPLVYLN + +GCV R+AAKLEMMEPCSSVKDRIG+SMI+DAE+KGLI+PGESVLIEPTSGNTG+GLAF AAAKGY+LIITMPASMS+ERR++LLAFG ELVLTDPA+GMK A+ KAE
Sbjct:    3 SRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEQKGLIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSVERRIILLAFGVELVLTDPAKGMKGAIAKAE 133          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK1_ARATH (Cysteine synthase OS=Arabidopsis thaliana GN=OASA1 PE=1 SV=2)

HSP 1 Score: 219.164 bits (557), Expect = 1.468e-56
Identity = 108/131 (82.44%), Postives = 121/131 (92.37%), Query Frame = 2
Query:  248 SVIAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            S IAKDVTELIG TPLVYLN + +GCV R+AAKLEMMEPCSSVKDRIG+SMI+DAE+KGLI+PGESVLIEPTSGNTG+GLAF AAAKGY+LIITMPASMS ERR++LLAFG ELVLTDPA+GMK A+ KAE
Sbjct:    3 SRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPAKGMKGAIAKAE 133          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK_WHEAT (Cysteine synthase OS=Triticum aestivum GN=CYS1 PE=2 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 2.504e-56
Identity = 108/129 (83.72%), Postives = 118/129 (91.47%), Query Frame = 2
Query:  254 IAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            IAKDVTELIG TPLVYLN++ DGCV R+AAKLE MEPCSSVKDRIGYSMI DAEEKG I PG+SVLIEPTSGNTGIGLAFMAAAKGYRL++TMPASMS+ERR++L AFGAEL+LTDP  GMK AVQKAE
Sbjct:    9 IAKDVTELIGNTPLVYLNKVTDGCVGRVAAKLESMEPCSSVKDRIGYSMITDAEEKGFIVPGKSVLIEPTSGNTGIGLAFMAAAKGYRLVLTMPASMSMERRIILKAFGAELILTDPLLGMKGAVQKAE 137          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK2_BRAJU (Cysteine synthase OS=Brassica juncea PE=2 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 4.271e-56
Identity = 106/129 (82.17%), Postives = 120/129 (93.02%), Query Frame = 2
Query:  254 IAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            IA DVTELIG TPLVYLN + +GCV R+AAKLEMMEPCSSVKDRIG+SMI+DAE+KGLI+PGESVLIEPTSGNTG+GLAF AAAKGY+LIITMPASMS+ERR++LLAFG ELVLTDPA+GMK A+ KAE
Sbjct:    7 IANDVTELIGNTPLVYLNSVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSIERRIILLAFGVELVLTDPAKGMKGAIAKAE 135          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK2_ORYSJ (Cysteine synthase OS=Oryza sativa subsp. japonica GN=RCS3 PE=2 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 2.768e-55
Identity = 107/129 (82.95%), Postives = 119/129 (92.25%), Query Frame = 2
Query:  254 IAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            IA DVT LIG TPLVYLN++VDGC A+IAAKLE+MEPCSSVKDRIGYSMI DAEEKGLI PG+SVLIEPTSGNTGIGLAFMAAAKGY+LI+TMPASMS+ERR++L AFGAELVLTDP  GMK A+QKA+
Sbjct:    8 IASDVTALIGNTPLVYLNKVVDGCEAQIAAKLEIMEPCSSVKDRIGYSMITDAEEKGLITPGKSVLIEPTSGNTGIGLAFMAAAKGYKLILTMPASMSMERRIILKAFGAELVLTDPLLGMKGAIQKAD 136          
BLAST of FC931458 vs. ExPASy Swiss-Prot
Match: CYSK_MAIZE (Cysteine synthase OS=Zea mays PE=1 SV=2)

HSP 1 Score: 211.846 bits (538), Expect = 2.344e-54
Identity = 107/129 (82.95%), Postives = 115/129 (89.15%), Query Frame = 2
Query:  254 IAKDVTELIGKTPLVYLNRIVDGCVARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLIRPGESVLIEPTSGNTGIGLAFMAAAKGYRLIITMPASMSLERRMVLLAFGAELVLTDPARGMKRAVQKAE 640
            IAKDVTELIG TPLVYLN++ DGCV R  AKLE MEPCSSVKDRIGYSMI DAEEKGLI PG SVLIEPTSGNTGIGLAFMAAAKGY+L +TMPASMS+ERR++L AFGAELVLTDP  GMK AV+KAE
Sbjct:    8 IAKDVTELIGNTPLVYLNKVTDGCVGRSRAKLESMEPCSSVKDRIGYSMITDAEEKGLITPGVSVLIEPTSGNTGIGLAFMAAAKGYKLTLTMPASMSMERRIILKAFGAELVLTDPLLGMKGAVKKAE 136          
The following BLAST results are available for this feature:
BLAST of FC931458 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 64
Match NameE-valueIdentityDescription
CYSK_CITLA3.733e-6090.08Cysteine synthase OS=Citrullus lanatus PE=2 SV=1[more]
CYSK1_ORYSJ2.265e-5785.27Cysteine synthase OS=Oryza sativa subsp. japonica ... [more]
CYSK_SPIOL5.045e-5786.05Cysteine synthase OS=Spinacia oleracea PE=1 SV=1[more]
CYSK_SOLTU5.045e-5784.50Cysteine synthase OS=Solanum tuberosum PE=2 SV=1[more]
CYSK1_BRAJU6.589e-5782.44Cysteine synthase OS=Brassica juncea PE=2 SV=1[more]
CYSK1_ARATH1.468e-5682.44Cysteine synthase OS=Arabidopsis thaliana GN=OASA1... [more]
CYSK_WHEAT2.504e-5683.72Cysteine synthase OS=Triticum aestivum GN=CYS1 PE=... [more]
CYSK2_BRAJU4.271e-5682.17Cysteine synthase OS=Brassica juncea PE=2 SV=1[more]
CYSK2_ORYSJ2.768e-5582.95Cysteine synthase OS=Oryza sativa subsp. japonica ... [more]
CYSK_MAIZE2.344e-5482.95Cysteine synthase OS=Zea mays PE=1 SV=2[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34105C12EF PostHarvP1 Citrus clementina cDNA clone C34105C12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931458 ID=FC931458|Name=FC931458|organism=Citrus clementina|type=EST|length=640bp
GATGTTTATTTATTTATTCATTTTTATTTTTTGTTTTGTTCTATATTTCT
CATTTGGCCGCCTGAAGAATATTTATATAAGCAAAATCATCGTAACGCAT
AAACATAATTATTATCGGGAGATTTATTTGTTTTTCAATTTTCTACTGTT
TTCCAGCTGCCTTGACATTGTTTACGATTCTTCCCAGAGAAAGCTTTCGC
GTTCGCTTGTAACTTGAAAAAAAGAAAAAAAAATGGTGGAGGAGAAGTCC
GTGATTGCGAAAGATGTCACTGAATTGATTGGTAAAACACCATTGGTGTA
TCTCAACCGCATTGTGGATGGTTGCGTTGCTAGAATTGCTGCCAAGCTGG
AGATGATGGAACCCTGCTCTAGCGTCAAAGATAGAATTGGATACAGTATG
ATCGCTGATGCAGAGGAGAAGGGTCTCATTAGACCAGGCGAGAGTGTCCT
GATTGAGCCTACCAGCGGTAATACTGGCATAGGGTTGGCATTCATGGCAG
CTGCTAAGGGTTACAGACTTATAATTACCATGCCTGCTTCAATGAGTCTT
GAAAGAAGAATGGTTCTCCTAGCTTTTGGAGCTGAGCTTGTGCTCACTGA
TCCTGCCAGGGGCATGAAGAGAGCTGTTCAGAAGGCAGAA
back to top