FC931588

Overview
NameFC931588
Unique NameFC931588
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length723
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC931588_ssr25 microsatellite FC931588_ssr25:25..38. BLAST: Citrus ESTs to Prunus persica proteins V1
FC931588_ssr124 microsatellite FC931588_ssr124:124..138. BLAST: Citrus ESTs to Prunus persica proteins V1
FC931588_ssr185 microsatellite FC931588_ssr185:185..196. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig10238 contig Ccv1_Contig10238:1..724. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931588 vs. ExPASy Swiss-Prot
Match: NEC1_NICPL (Nectarin-1 OS=Nicotiana plumbaginifolia GN=NEC1 PE=1 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 1.108e-61
Identity = 112/146 (76.71%), Postives = 127/146 (86.99%), Query Frame = 1
Query:  190 AADPEMLQDVCVADLTSPIKVNGFPCKANFSEMDFFSDKLAKPAATNNTFGSTVTAANVQTIPGLNTLGVSLARIDYAPGGINPPHTHPRATEIVFVLEGQLDVGFFTTANVLVSKSIKKGENFVFPRGLVHFQKNNGNVPASVIA 627
            AAD +MLQDVCVADL S +KVNGFPCK NF+  DF S  ++KP ATNN FGS VT ANV+ +PGLNTLGVSLARIDYAPGGINPPHTHPRA+E+VFV+EG+LDVGF TTANVLVSK I KGE FVFPRGLVHFQKNNG +PA+V++
Sbjct:   32 AADEDMLQDVCVADLHSKVKVNGFPCKTNFTAADFSSFAISKPGATNNKFGSKVTTANVEQVPGLNTLGVSLARIDYAPGGINPPHTHPRASEMVFVMEGELDVGFITTANVLVSKQITKGEVFVFPRGLVHFQKNNGKIPAAVVS 177          
BLAST of FC931588 vs. ExPASy Swiss-Prot
Match: NEC1_NICLS (Nectarin-1 OS=Nicotiana langsdorffii x Nicotiana sanderae GN=NECI PE=1 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 1.108e-61
Identity = 114/146 (78.08%), Postives = 127/146 (86.99%), Query Frame = 1
Query:  190 AADPEMLQDVCVADLTSPIKVNGFPCKANFSEMDFFSDKLAKPAATNNTFGSTVTAANVQTIPGLNTLGVSLARIDYAPGGINPPHTHPRATEIVFVLEGQLDVGFFTTANVLVSKSIKKGENFVFPRGLVHFQKNNGNVPASVIA 627
            AAD +MLQDVCVADL S +KVNGFPCK NF+  DF S  ++KP ATNN FGS VT ANV+ +PGLNTLGVSLARIDYAPGGINPPHTHPRA+E+VFV+EG+LDVGF TTANVLVSK I KGE FVFPRGLVHFQKNNG VPA+VI+
Sbjct:   32 AADEDMLQDVCVADLHSKVKVNGFPCKTNFTAADFSSLAISKPGATNNKFGSVVTTANVEQVPGLNTLGVSLARIDYAPGGINPPHTHPRASEMVFVMEGELDVGFITTANVLVSKKIIKGEVFVFPRGLVHFQKNNGEVPAAVIS 177          
BLAST of FC931588 vs. ExPASy Swiss-Prot
Match: RHRE_PEA (Rhicadhesin receptor OS=Pisum sativum GN=GER1 PE=1 SV=2)

HSP 1 Score: 221.09 bits (562), Expect = 1.881e-61
Identity = 110/149 (73.83%), Postives = 123/149 (82.55%), Query Frame = 1
Query:  190 AADPEMLQDVCVADLTSPIKVNGFPCK--ANFSEMDFFSDKLAKPAATNNTFGSTVTAANVQTIPGLNTLGVSLARIDYAPGGINPPHTHPRATEIVFVLEGQLDVGFFTTANVLVSKSIKKGENFVFPRGLVHFQKNNGNVPASVIAG 630
            AAD + LQD+CVAD  S I VNGF CK  +N +  DFFS+ L K  ATNNTFGS VT ANVQ IPGLNTLGVS+ARIDYAPGG+NPPHTHPRATE+VFVLEGQLDVGF TT N L++K+I KGE FVFP+GLVHFQKNNG  PA+VIAG
Sbjct:   20 AADADALQDLCVADYASVILVNGFACKPASNVTAEDFFSNLLVKQGATNNTFGSLVTGANVQRIPGLNTLGVSMARIDYAPGGLNPPHTHPRATEMVFVLEGQLDVGFITTTNQLIAKTIAKGETFVFPKGLVHFQKNNGWEPATVIAG 168          

HSP 2 Score: 36.5798 bits (83), Expect = 1.881e-61
Identity = 18/31 (58.06%), Postives = 19/31 (61.29%), Query Frame = 3
Query:  609 PCFCYCWLNSQLQGTQNIALTLFASTPPVAD 701
            P       NSQL GT NI LTLF +TPPV D
Sbjct:  162 PATVIAGFNSQLPGTVNIPLTLFNATPPVPD 192          
BLAST of FC931588 vs. ExPASy Swiss-Prot
Match: GL21_ARATH (Germin-like protein subfamily 2 member 1 OS=Arabidopsis thaliana GN=GLP4 PE=2 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 2.468e-61
Identity = 113/150 (75.33%), Postives = 130/150 (86.67%), Query Frame = 1
Query:  184 TAAADPEMLQDVCVADLTSPIKVNGFPCK--ANFSEMDFFSDKLAKPAATNNTFGSTVTAANVQTIPGLNTLGVSLARIDYAPGGINPPHTHPRATEIVFVLEGQLDVGFFTTANVLVSKSIKKGENFVFPRGLVHFQKNNGNVPASVIA 627
            +++ADP+MLQD+CVADL S IK+NGFPCK  A  +  DFFS  LAKP  TNNTFG+ VT ANV TIPGLNTLGVSL+RIDYAPGG+NPPHTHPRATE+VFVLEG LDVGF TTAN L+S+S+KKG+ F FP+GLVHFQKNNG+VPASVIA
Sbjct:   20 SSSADPDMLQDLCVADLPSGIKINGFPCKDAATVTSADFFSQGLAKPGLTNNTFGALVTGANVMTIPGLNTLGVSLSRIDYAPGGLNPPHTHPRATEVVFVLEGTLDVGFLTTANKLISQSLKKGDVFAFPKGLVHFQKNNGDVPASVIA 169          
BLAST of FC931588 vs. ExPASy Swiss-Prot
Match: GL24_ARATH (Germin-like protein subfamily 2 member 4 OS=Arabidopsis thaliana GN=GLP10 PE=2 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 1.555e-57
Identity = 104/149 (69.80%), Postives = 120/149 (80.54%), Query Frame = 1
Query:  190 AADPEMLQDVCVADLTSPIKVNGFPCK--ANFSEMDFFSDKLAKPAATNNTFGSTVTAANVQTIPGLNTLGVSLARIDYAPGGINPPHTHPRATEIVFVLEGQLDVGFFTTANVLVSKSIKKGENFVFPRGLVHFQKNNGNV-PASVIA 627
            A DP+ LQD+CVAD TS IKVNGF CK  +N +  DFF   + KPA  NNT GS VT ANV+ I GLNTLGVSLARIDYAPGG+NPPHTHPRATE++FVLEG+LDVGF TTAN L +K++KKGE FVFPRGL+H+QKNN    PASVI+
Sbjct:   21 AYDPDTLQDLCVADRTSGIKVNGFTCKPESNITASDFFFAGIGKPAVVNNTVGSAVTGANVEKIAGLNTLGVSLARIDYAPGGLNPPHTHPRATEVIFVLEGELDVGFITTANKLFAKTVKKGEVFVFPRGLIHYQKNNDKAKPASVIS 169          

HSP 2 Score: 34.2686 bits (77), Expect = 1.555e-57
Identity = 15/23 (65.22%), Postives = 18/23 (78.26%), Query Frame = 3
Query:  633 NSQLQGTQNIALTLFASTPPVAD 701
            NSQL GTQ+IA TLF +TP + D
Sbjct:  172 NSQLPGTQSIAATLFTATPAIPD 194          
BLAST of FC931588 vs. ExPASy Swiss-Prot
Match: GL11_ORYSJ (Germin-like protein 1-1 OS=Oryza sativa subsp. japonica GN=GER4 PE=2 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 3.122e-56
Identity = 105/146 (71.92%), Postives = 120/146 (82.19%), Query Frame = 1
Query:  190 AADPEMLQDVCVADLTSPIKVNGFPCKANFSEMDFFSDKLAKPAATNNTFGSTVTAANVQTIPGLNTLGVSLARIDYAPGGINPPHTHPRATEIVFVLEGQLDVGFFTTANVLVSKSIKKGENFVFPRGLVHFQKNNGNVPASVIA 627
            A DP+MLQDVCVADL SP+K+NGFPCKAN +  DFF   L  P  TNN  GS VTAANVQ+ PG+NTLGVS+ARIDYAPGG NPPHTHPRATEI+FVLEG L+VGF TTAN L +K++  GE FVFPRGLVHFQ+N G+ PA+VIA
Sbjct:   24 AGDPDMLQDVCVADLASPVKLNGFPCKANVTADDFFFAGLKNPGNTNNPAGSNVTAANVQSFPGVNTLGVSMARIDYAPGGQNPPHTHPRATEIIFVLEGVLEVGFITTANKLFTKTVTAGEVFVFPRGLVHFQQNRGHGPAAVIA 169          
BLAST of FC931588 vs. ExPASy Swiss-Prot
Match: GL52_ORYSJ (Germin-like protein 5-1 OS=Oryza sativa subsp. japonica GN=Os05g0277500 PE=2 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 9.084e-56
Identity = 101/148 (68.24%), Postives = 123/148 (83.11%), Query Frame = 1
Query:  184 TAAADPEMLQDVCVADLTSPIKVNGFPCKANFSEMDFFSDKLAKPAATNNTFGSTVTAANVQTIPGLNTLGVSLARIDYAPGGINPPHTHPRATEIVFVLEGQLDVGFFTTANVLVSKSIKKGENFVFPRGLVHFQKNNGNVPASVIA 627
            + A DP++LQD+CVADLTS +KVNGF CKA  +E DF+   LA    TNNT+GS VT ANV+ +PGLNTLGVS++RIDYAPGG+NPPHTHPRATE+VFVL+G LDVGF TTAN L +K+I  G+ FVFPRGL+HFQKNNG+ PA+VI+
Sbjct:   23 STAGDPDLLQDICVADLTSAVKVNGFACKAAVTEDDFYFKGLAAAGNTNNTYGSVVTGANVEKLPGLNTLGVSMSRIDYAPGGLNPPHTHPRATEMVFVLQGTLDVGFITTANKLYTKTISAGDVFVFPRGLLHFQKNNGDTPAAVIS 170          
BLAST of FC931588 vs. ExPASy Swiss-Prot
Match: GL22_ARATH (Germin-like protein subfamily 2 member 2 OS=Arabidopsis thaliana GN=At1g02335 PE=2 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.111e-53
Identity = 102/148 (68.92%), Postives = 120/148 (81.08%), Query Frame = 1
Query:  190 AADPEMLQDVCVADLTSPIKVNGFPCKA--NFSEMDFFSDKLAKPAATNNTFGSTVTAANVQTIPGLNTLGVSLARIDYAPGGINPPHTHPRATEIVFVLEGQLDVGFFTTANVLVSKSIKKGENFVFPRGLVHFQKNNGNVPASVIA 627
            A DP+ LQD+CVAD +   K+NGFPCK   N +E DFF   ++KPA  N+T GS VT ANV+ IPGLNTL VSLARIDYAPGG+NPPHTHPRATE+V+VLEG+L+VGF TTAN L +K+IK GE FVFPRGLVHFQKNNG  PASV++
Sbjct:   22 AYDPDALQDLCVADKSHGTKLNGFPCKETLNITESDFFFAGISKPAVINSTMGSAVTGANVEKIPGLNTLSVSLARIDYAPGGLNPPHTHPRATEVVYVLEGELEVGFITTANKLFTKTIKIGEVFVFPRGLVHFQKNNGKSPASVLS 169          
BLAST of FC931588 vs. ExPASy Swiss-Prot
Match: GL13_ORYSJ (Germin-like protein 1-3 OS=Oryza sativa subsp. japonica GN=GER8 PE=2 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 7.198e-53
Identity = 102/153 (66.67%), Postives = 120/153 (78.43%), Query Frame = 1
Query:  190 AADPEMLQDVCVAD---LTSPIKVNGFPCKA--NFSEMDFFSDKLAKPAATNNTFGSTVTAANVQTIPGLNTLGVSLARIDYAPGGINPPHTHPRATEIVFVLEGQLDVGFFTTANVLVSKSIKKGENFVFPRGLVHFQKNNGNVPASVIAGL 633
            A DP+MLQDVCVAD   L  P+++NGFPCK   N +  DFF D L K   T N  GS VTAA+V+++PGLNT+GVS+ARIDYAP G+NPPHTHPRATEI+FV+EG LDVGF TTAN L ++++ KGE FVFPRGLVHFQKNNGN PA  IA L
Sbjct:   22 AGDPDMLQDVCVADYKSLKGPLRLNGFPCKRIENVTANDFFFDGLMKAGNTGNAVGSVVTAASVESLPGLNTMGVSMARIDYAPWGLNPPHTHPRATEIIFVVEGSLDVGFVTTANKLFTRTVCKGEVFVFPRGLVHFQKNNGNTPAFAIAAL 174          
BLAST of FC931588 vs. ExPASy Swiss-Prot
Match: GL32_ORYSJ (Putative germin-like protein 3-2 OS=Oryza sativa subsp. japonica GN=Os03g0651800 PE=3 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 3.353e-51
Identity = 95/151 (62.91%), Postives = 114/151 (75.50%), Query Frame = 1
Query:  190 AADPEMLQDVCVAD---LTSPIKVNGFPCKA--NFSEMDFFSDKLAKPAATNNTFGSTVTAANVQTIPGLNTLGVSLARIDYAPGGINPPHTHPRATEIVFVLEGQLDVGFFTTANVLVSKSIKKGENFVFPRGLVHFQKNNGNVPASVIA 627
            A DP+MLQDVCVAD   L  P+++NG PCK   N +  DFF D L     T N  GS VTAA+V+ +PGLNT+GVS+ARIDYAP G++PPHTHPRATEI+FV EG LDVGF TTAN L ++++ KGE FVFPRGLVHFQ+N+GN  A  IA
Sbjct:   22 AGDPDMLQDVCVADYKSLRGPLRLNGIPCKRLENVTANDFFFDGLTNAGNTTNAVGSLVTAASVERLPGLNTMGVSMARIDYAPWGLSPPHTHPRATEIMFVAEGTLDVGFVTTANKLFTRTVSKGEVFVFPRGLVHFQRNSGNTSALAIA 172          

HSP 2 Score: 31.5722 bits (70), Expect = 3.353e-51
Identity = 14/21 (66.67%), Postives = 17/21 (80.95%), Query Frame = 3
Query:  633 NSQLQGTQNIALTLFASTPPV 695
            NSQL GTQ+IA TLF + PP+
Sbjct:  175 NSQLPGTQSIADTLFGAAPPL 195          
The following BLAST results are available for this feature:
BLAST of FC931588 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 88
Match NameE-valueIdentityDescription
NEC1_NICPL1.108e-6176.71Nectarin-1 OS=Nicotiana plumbaginifolia GN=NEC1 PE... [more]
NEC1_NICLS1.108e-6178.08Nectarin-1 OS=Nicotiana langsdorffii x Nicotiana s... [more]
RHRE_PEA1.881e-6173.83Rhicadhesin receptor OS=Pisum sativum GN=GER1 PE=1... [more]
GL21_ARATH2.468e-6175.33Germin-like protein subfamily 2 member 1 OS=Arabid... [more]
GL24_ARATH1.555e-5769.80Germin-like protein subfamily 2 member 4 OS=Arabid... [more]
GL11_ORYSJ3.122e-5671.92Germin-like protein 1-1 OS=Oryza sativa subsp. jap... [more]
GL52_ORYSJ9.084e-5668.24Germin-like protein 5-1 OS=Oryza sativa subsp. jap... [more]
GL22_ARATH1.111e-5368.92Germin-like protein subfamily 2 member 2 OS=Arabid... [more]
GL13_ORYSJ7.198e-5366.67Germin-like protein 1-3 OS=Oryza sativa subsp. jap... [more]
GL32_ORYSJ3.353e-5162.91Putative germin-like protein 3-2 OS=Oryza sativa s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34106G09EF PostHarvP1 Citrus clementina cDNA clone C34106G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931588 ID=FC931588|Name=FC931588|organism=Citrus clementina|type=EST|length=723bp
GGTCAACAAATCAACACCAACTTTTCTCTCTCTCTCTCTTTCTCCATCTC
TATCTTTTCTTCTTTCTTTATCTTCGCCTGCAGCAATAACAAGATCATAA
TTGAACTTACTTTTGTAACCATGGCTGCTGCTGCTGCTGGTGCTTTGACA
CTTTTTGTTGTCACTGTTGCTGTGATCTTGAACACTGCTGCTGCTGATCC
CGAAATGCTTCAAGATGTTTGTGTGGCAGACCTCACTTCCCCTATTAAAG
TCAATGGGTTCCCCTGCAAAGCAAACTTTTCAGAGATGGACTTTTTCTCA
GACAAATTAGCAAAGCCAGCAGCCACAAACAACACGTTTGGTTCAACAGT
AACAGCAGCCAATGTCCAAACAATCCCAGGCCTAAATACTCTTGGTGTCT
CACTCGCACGCATTGACTATGCCCCCGGCGGCATAAACCCGCCGCACACG
CACCCCCGTGCCACCGAGATCGTCTTTGTCCTCGAGGGTCAACTCGACGT
AGGCTTCTTCACTACTGCCAACGTTTTGGTATCAAAATCCATCAAAAAGG
GTGAAAACTTCGTGTTTCCAAGAGGGTTGGTGCATTTCCAGAAGAACAAT
GGAAATGTCCCTGCTTCTGTTATTGCTGGCTTAATAGCCAGCTGCAGGGG
ACTCAGAACATTGCTCTTACATTGTTTGCATCTACGCCGCCAGTGGCGGA
TATGTATGACTAGACTTTCAGAT
back to top