FC931596

Overview
NameFC931596
Unique NameFC931596
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length685
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15273 contig Ccv1_Contig15273:28..712. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931596 vs. ExPASy Swiss-Prot
Match: AGL9_PETHY (Agamous-like MADS-box protein AGL9 homolog OS=Petunia hybrida GN=FBP2 PE=1 SV=2)

HSP 1 Score: 364.385 bits (934), Expect = 3.204e-100
Identity = 188/220 (85.45%), Postives = 198/220 (90.00%), Query Frame = 2
Query:   23 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCGYGLKPAQPQGDTFFHALECEPTLXIGYQ 682
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPE N+S REALE+SSQQEYLKLKARYEALQRSQRNLLGE+LGPLNSKELESLERQLDMSLKQIRSTRTQ MLD L +LQ KE  L+EAN+TLKQRLMEG  +N LQ   +A+D GYG +  Q QGD FFH LECEPTL IGYQ
Sbjct:    1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPETNISTREALEISSQQEYLKLKARYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLQDLQRKEHALNEANRTLKQRLMEGSTLN-LQWQQNAQDVGYGRQATQTQGDGFFHPLECEPTLQIGYQ 219          
BLAST of FC931596 vs. ExPASy Swiss-Prot
Match: MTF1_PEA (MADS-box transcription factor 1 OS=Pisum sativum GN=MTF1 PE=2 SV=1)

HSP 1 Score: 337.035 bits (863), Expect = 5.477e-92
Identity = 177/224 (79.02%), Postives = 196/224 (87.50%), Query Frame = 2
Query:   23 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREA--LELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCGYGL-KPAQPQGDTFFHA--LECEPTLXIGY 679
            MGRGRVELKR+ENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEFCS+SSMLKTLERYQKCNYGAPE NV+++EA  LELSSQQEYLKLKARYE+LQRSQRNL+GE+LGPL+SK+LE+LERQLD SLKQIRSTRTQ+MLD L +LQ KE LL EAN+ L+QR MEGYQ+N+LQLN SAED GYG        GD  F    +ECEPTL IGY
Sbjct:    1 MGRGRVELKRVENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSTSSMLKTLERYQKCNYGAPEGNVTSKEALVLELSSQQEYLKLKARYESLQRSQRNLMGEDLGPLSSKDLETLERQLDSSLKQIRSTRTQFMLDQLGDLQRKEHLLCEANRALRQR-MEGYQINSLQLNLSAEDMGYGRHHQGHTHGDELFQVQPIECEPTLQIGY 223          
BLAST of FC931596 vs. ExPASy Swiss-Prot
Match: SEP3_ARATH (Developmental protein SEPALLATA 3 OS=Arabidopsis thaliana GN=SEP3 PE=1 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 2.544e-89
Identity = 175/225 (77.78%), Postives = 193/225 (85.78%), Query Frame = 2
Query:   23 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREAL--ELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAEDCG-YGLKPAQPQ--GDTFFHALECEPTLXIGYQ 682
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSML+TLERYQKCNYGAPEPNV +REAL  ELSSQQEYLKLK RY+ALQR+QRNLLGE+LGPL++KELESLERQLD SLKQIR+ RTQ+MLD L +LQ KE++L+E NKTL+ RL +GYQ+  LQLNP+ E+   YG    Q Q     FF  LECEP L IGYQ
Sbjct:    1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLRTLERYQKCNYGAPEPNVPSREALAVELSSQQEYLKLKERYDALQRTQRNLLGEDLGPLSTKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKTLRLRLADGYQM-PLQLNPNQEEVDHYGRHHHQQQQHSQAFFQPLECEPILQIGYQ 224          
BLAST of FC931596 vs. ExPASy Swiss-Prot
Match: AGL9_SINAL (Agamous-like MADS-box protein AGL9 homolog OS=Sinapis alba GN=AGL9 PE=2 SV=1)

HSP 1 Score: 323.553 bits (828), Expect = 6.267e-88
Identity = 172/227 (75.77%), Postives = 193/227 (85.02%), Query Frame = 2
Query:   23 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREAL--ELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAED--CGYGLKPAQPQGDT---FFHALECEPTLXIGYQ 682
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSM++TLERYQKCNYG PEPNV +REAL  ELSSQQEYLKLK RY+ALQR+QRNLLGE+LGPL++KELE LERQLD SLKQIR+ RTQ+MLD L +LQ KE++L+E NKTL+ RL +GYQ+  LQLNP+ ED    YG    Q Q ++   FF  LECEP L +GYQ
Sbjct:    1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMIRTLERYQKCNYGPPEPNVPSREALAVELSSQQEYLKLKERYDALQRTQRNLLGEDLGPLSTKELELLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLNETNKTLRLRLADGYQM-PLQLNPNQEDHHVDYGRHDQQQQQNSHHAFFQPLECEPILQMGYQ 226          
BLAST of FC931596 vs. ExPASy Swiss-Prot
Match: AGL9_SOLLC (Agamous-like MADS-box protein AGL9 homolog OS=Solanum lycopersicum GN=TDR5 PE=2 SV=1)

HSP 1 Score: 319.701 bits (818), Expect = 2.278e-87
Identity = 163/180 (90.56%), Postives = 170/180 (94.44%), Query Frame = 2
Query:   23 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVN 562
            MGRGRVELKRIE KINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPN+S REALE+SSQQEYLKLK RYEALQRSQRNLLGE+LGPLNSKELESLERQLDMSLKQIRSTRTQ MLD LT+ Q KE  L+EAN+TLKQRLMEG Q+N
Sbjct:    1 MGRGRVELKRIEGKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNISTREALEISSQQEYLKLKGRYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLTDYQRKEHALNEANRTLKQRLMEGSQLN 180          

HSP 2 Score: 24.6386 bits (52), Expect = 2.278e-87
Identity = 12/26 (46.15%), Postives = 15/26 (57.69%), Query Frame = 3
Query:  582 VQKIVVMGLNQLNLRAIPSFTPWNVN 659
            + K+  M   QL LRA+ SF  W VN
Sbjct:  186 MHKLWAMAGKQLKLRAMASFILWIVN 211          
BLAST of FC931596 vs. ExPASy Swiss-Prot
Match: AGL9_ARADE (Agamous-like MADS-box protein AGL9 homolog OS=Aranda deborah PE=2 SV=1)

HSP 1 Score: 312.768 bits (800), Expect = 1.106e-84
Identity = 165/221 (74.66%), Postives = 183/221 (82.81%), Query Frame = 2
Query:   23 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQL-NPS-AEDCGYGLKPAQPQGDTFFHALECEPTLXIGY 679
            MGRGRVELK IENKINRQVTFAKRR  LLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS+SMLKTLE+YQKCN+G+PE  + +RE    SSQQEYLKLK R EALQRSQRNLLGE+LGPL SKELE LERQLD SL+QIRSTRTQ+MLD L +LQ +EQ+L EANKTLK+R  E  Q N  Q+ +PS     GYG +PAQ  G+ F+H LECEPTL IGY
Sbjct:    1 MGRGRVELKMIENKINRQVTFAKRRKRLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSTSMLKTLEKYQKCNFGSPESTIISRET--QSSQQEYLKLKNRVEALQRSQRNLLGEDLGPLGSKELEQLERQLDSSLRQIRSTRTQFMLDQLADLQRREQMLCEANKTLKRRFEESSQANQQQVWDPSNTHAVGYGRQPAQHHGEAFYHPLECEPTLQIGY 219          
BLAST of FC931596 vs. ExPASy Swiss-Prot
Match: SEP1_ARATH (Developmental protein SEPALLATA 1 OS=Arabidopsis thaliana GN=SEP1 PE=1 SV=2)

HSP 1 Score: 276.944 bits (707), Expect = 6.726e-74
Identity = 150/225 (66.67%), Postives = 173/225 (76.89%), Query Frame = 2
Query:   23 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSA------EDCGYGLKPAQPQGDTFFHALECEPTLXIGY 679
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSS+MLKTL+RYQKC+YG+ E N    + LE +S +EYLKLK RYE LQR QRNLLGE+LGPLNSKELE LERQLD SLKQ+RS +TQYMLD L++LQ+KEQ+L E N+ L  +L +   V +  +          ++  Y    AQ QG   +  LEC PTL +GY
Sbjct:    1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSNMLKTLDRYQKCSYGSIEVNNKPAKELE-NSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQNKEQMLLETNRALAMKLDDMIGVRSHHMGGGGGWEGGEQNVTYAHHQAQSQG--LYQPLECNPTLQMGY 222          
BLAST of FC931596 vs. ExPASy Swiss-Prot
Match: SEP2_ARATH (Developmental protein SEPALLATA 2 OS=Arabidopsis thaliana GN=SEP2 PE=1 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 3.338e-73
Identity = 148/224 (66.07%), Postives = 172/224 (76.79%), Query Frame = 2
Query:   23 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQLNPSAE-----DCGYGLKPAQPQGDTFFHALECEPTLXIGY 679
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEV+LI+FSNRGKLYEFCS+S+MLKTLERYQKC+YG+ E N    + LE +S +EYLKLK RYE LQR QRNLLGE+LGPLNSKELE LERQLD SLKQ+R  +TQYMLD L++LQ KE +L +AN+ L  +L +   V    +    E     +  YG   A  QG   + +LEC+PTL IGY
Sbjct:    1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCSTSNMLKTLERYQKCSYGSIEVNNKPAKELE-NSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRCIKTQYMLDQLSDLQGKEHILLDANRALSMKLEDMIGVRHHHIGGGWEGGDQQNIAYGHPQAHSQG--LYQSLECDPTLQIGY 221          
BLAST of FC931596 vs. ExPASy Swiss-Prot
Match: MADS7_ORYSJ (MADS-box transcription factor 7 OS=Oryza sativa subsp. japonica GN=MADS7 PE=1 SV=2)

HSP 1 Score: 271.552 bits (693), Expect = 2.826e-72
Identity = 149/227 (65.64%), Postives = 175/227 (77.09%), Query Frame = 2
Query:   23 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALEL-SSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQL-NPSAEDCGYGLKPAQPQ----GDTFFHALEC--EPTLXIGY 679
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS+ SM KTLE+YQKC+Y  PE  V  RE+ +L +S+ EYLKLKAR E LQR+QRNLLGE+L  L  KELESLE+QLD SLK +R+TRT++++D LTELQ KEQ++SEAN+ L+++L E   V   Q+        GY  +P   Q    G+ FFH L+   EPTL IGY
Sbjct:    1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTQSMTKTLEKYQKCSYAGPETAVQNRESEQLKASRNEYLKLKARVENLQRTQRNLLGEDLDSLGIKELESLEKQLDSSLKHVRTTRTKHLVDQLTELQRKEQMVSEANRCLRRKLEESNHVRGQQVWEQGCNLIGYERQPEVQQPLHGGNGFFHPLDAAGEPTLQIGY 227          
BLAST of FC931596 vs. ExPASy Swiss-Prot
Match: MADS7_ORYSI (MADS-box transcription factor 7 OS=Oryza sativa subsp. indica GN=MADS7 PE=2 SV=2)

HSP 1 Score: 271.552 bits (693), Expect = 2.826e-72
Identity = 149/227 (65.64%), Postives = 175/227 (77.09%), Query Frame = 2
Query:   23 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPEPNVSAREALEL-SSQQEYLKLKARYEALQRSQRNLLGEELGPLNSKELESLERQLDMSLKQIRSTRTQYMLDTLTELQHKEQLLSEANKTLKQRLMEGYQVNTLQL-NPSAEDCGYGLKPAQPQ----GDTFFHALEC--EPTLXIGY 679
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS+ SM KTLE+YQKC+Y  PE  V  RE+ +L +S+ EYLKLKAR E LQR+QRNLLGE+L  L  KELESLE+QLD SLK +R+TRT++++D LTELQ KEQ++SEAN+ L+++L E   V   Q+        GY  +P   Q    G+ FFH L+   EPTL IGY
Sbjct:    1 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTQSMTKTLEKYQKCSYAGPETAVQNRESEQLKASRNEYLKLKARVENLQRTQRNLLGEDLDSLGIKELESLEKQLDSSLKHVRTTRTKHLVDQLTELQRKEQMVSEANRCLRRKLEESNHVRGQQVWEQGCNLIGYERQPEVQQPLHGGNGFFHPLDAAGEPTLQIGY 227          
The following BLAST results are available for this feature:
BLAST of FC931596 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 118
Match NameE-valueIdentityDescription
AGL9_PETHY3.204e-10085.45Agamous-like MADS-box protein AGL9 homolog OS=Petu... [more]
MTF1_PEA5.477e-9279.02MADS-box transcription factor 1 OS=Pisum sativum G... [more]
SEP3_ARATH2.544e-8977.78Developmental protein SEPALLATA 3 OS=Arabidopsis t... [more]
AGL9_SINAL6.267e-8875.77Agamous-like MADS-box protein AGL9 homolog OS=Sina... [more]
AGL9_SOLLC2.278e-8790.56Agamous-like MADS-box protein AGL9 homolog OS=Sola... [more]
AGL9_ARADE1.106e-8474.66Agamous-like MADS-box protein AGL9 homolog OS=Aran... [more]
SEP1_ARATH6.726e-7466.67Developmental protein SEPALLATA 1 OS=Arabidopsis t... [more]
SEP2_ARATH3.338e-7366.07Developmental protein SEPALLATA 2 OS=Arabidopsis t... [more]
MADS7_ORYSJ2.826e-7265.64MADS-box transcription factor 7 OS=Oryza sativa su... [more]
MADS7_ORYSI2.826e-7265.64MADS-box transcription factor 7 OS=Oryza sativa su... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34106H07EF PostHarvP1 Citrus clementina cDNA clone C34106H07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931596 ID=FC931596|Name=FC931596|organism=Citrus clementina|type=EST|length=685bp
GGAAGAAAGAAAGGAGAAGAAAATGGGAAGGGGTAGGGTTGAGTTGAAGA
GGATAGAGAACAAGATCAACAGGCAAGTGACCTTTGCAAAGAGAAGAAAT
GGCCTATTGAAGAAAGCTTATGAGCTTTCCGTTCTTTGTGATGCTGAGGT
TGCTCTCATCATTTTCTCCAATAGAGGAAAGCTGTACGAGTTTTGCAGTA
GTTCAAGCATGCTCAAAACGCTTGAGAGGTACCAGAAGTGCAACTATGGA
GCACCAGAACCGAATGTGTCCGCAAGGGAGGCCCTGGAGCTAAGTAGCCA
GCAAGAATATCTGAAGCTTAAAGCACGATATGAAGCCCTACAGAGATCCC
AAAGGAATCTCCTTGGAGAAGAACTTGGCCCTCTAAACAGCAAAGAGCTT
GAGTCACTTGAAAGGCAGCTTGATATGTCATTGAAGCAGATCAGATCAAC
AAGAACTCAGTACATGCTGGATACCCTTACTGAACTGCAACATAAGGAAC
AGTTGCTGAGCGAAGCAAATAAGACCCTCAAACAAAGGTTGATGGAGGGA
TACCAAGTGAACACACTTCAATTGAATCCTAGTGCAGAAGATTGTGGTTA
TGGGCTTAAACCAGCTCAACCTCAGGGCGATACCTTCTTTCACGCCTTGG
AATGTGAACCCACATTGNCAATTGGATACCAGCCT
back to top