FC931773

Overview
NameFC931773
Unique NameFC931773
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length758
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15389 contig Ccv1_Contig15389:1..758. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931773 vs. ExPASy Swiss-Prot
Match: RTNLE_ARATH (Reticulon-like protein B5 OS=Arabidopsis thaliana GN=RTNLB5 PE=1 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 3.616e-66
Identity = 125/215 (58.14%), Postives = 151/215 (70.23%), Query Frame = 1
Query:  112 EREENPAEPPMEKVSEKIXXXXXXXXXXXXXXNEEPAAQSSVKADIYRLFGRERPVHQVFGGGKPADVFLWRNKKISAGVLGGATAIWVLFELFEYHLLTLVCHTXXXXXXXXXXWANAHTFIKKAPPCIPEVHLPEEPFLQVASAFRIELNHAFAVLRSIASGRDLKSFLMAIAALWVLSVVGSWCNFLTLFYIALVLLHILPGLYEKYEGQID 756
            E+     E  MEK+SEKI               E+P + S+VKA IYR+FGRE+PVH+V GGGKPADVFLWR+KK+S  VLG ATAIWVLFEL EYHLL+L+CH           W+NAHT I K  P IPE+H+PEE FL VAS+ R ELN AF +LRSIA GRDLK FLM +  LW++SVVG+W NFLTL YI  V+LH +P LYEK+E ++D
Sbjct:    6 EKSVPTEESLMEKISEKIHHHDSSSSSESEY--EKPDSPSAVKAKIYRMFGREKPVHKVLGGGKPADVFLWRDKKLSGAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTLINKTSPQIPEIHVPEEAFLVVASSLRNELNQAFVILRSIALGRDLKKFLMVVVGLWIISVVGNWFNFLTLVYICFVILHTVPMLYEKHEDKVD 218          
BLAST of FC931773 vs. ExPASy Swiss-Prot
Match: RTNLA_ARATH (Reticulon-like protein B1 OS=Arabidopsis thaliana GN=RTNLB1 PE=1 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 2.592e-64
Identity = 122/216 (56.48%), Postives = 151/216 (69.91%), Query Frame = 1
Query:  133 EPPMEKVSEKIXXXXXXXXXXXXXXNEEP--------AAQSSVKADIYRLFGRERPVHQVFGGGKPADVFLWRNKKISAGVLGGATAIWVLFELFEYHLLTLVCHTXXXXXXXXXXWANAHTFIKKAPPCIPEVHLPEEPFLQVASAFRIELNHAFAVLRSIASGRDLKSFLMAIAALWVLSVVGSWCNFLTLFYIALVLLHILPGLYEKYEGQID 756
            E  M+K+SEKI              +E+         +  SS+K+ +YRLFGRE+PVH+V GGGKPAD+F+W+NKK+S GVLGGATA WV+FEL EYHLLTL+CH           W+NA  FI K+PP IPEVH+PEEP LQ+AS  RIE+N  F+ LR IASGRDLK FL+AIA LWVLS++G   NFLTL YIALVLL  +P  Y+KYE ++D
Sbjct:   24 ESLMDKISEKIHHGGDSSSSSSSSDDEDEKKKTKKPSSPSSSMKSKVYRLFGREQPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVVFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREIASGRDLKKFLIAIAGLWVLSILGGCFNFLTLAYIALVLLFTVPLAYDKYEDKVD 239          
BLAST of FC931773 vs. ExPASy Swiss-Prot
Match: RTNLF_ARATH (Reticulon-like protein B6 OS=Arabidopsis thaliana GN=RTNLB6 PE=1 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 1.680e-63
Identity = 120/215 (55.81%), Postives = 150/215 (69.77%), Query Frame = 1
Query:  112 EREENPAEPPMEKVSEKIXXXXXXXXXXXXXXNEEPAAQSSVKADIYRLFGRERPVHQVFGGGKPADVFLWRNKKISAGVLGGATAIWVLFELFEYHLLTLVCHTXXXXXXXXXXWANAHTFIKKAPPCIPEVHLPEEPFLQVASAFRIELNHAFAVLRSIASGRDLKSFLMAIAALWVLSVVGSWCNFLTLFYIALVLLHILPGLYEKYEGQID 756
            E+  +  E  MEK+++KI              +E+P + S++KA IYRLFGRE+PVH+V GGG PADVFLWR+KK+SA VLG ATAIWVLFEL EYH L+LVCH            +NAH F+ K PP IPE+H+ EE FL + SA R ELN AF +LRSIA GRDLK FLM +  LW++SVVG+W NFLTL YI  V+LH +P LYEK+E ++D
Sbjct:    6 EKSMHKEESLMEKIADKIHDHDSSSSSDSE--HEKPESPSALKAKIYRLFGREKPVHKVLGGGLPADVFLWRDKKLSASVLGVATAIWVLFELVEYHFLSLVCHILIFALAALFLLSNAHAFMNKTPPKIPEIHIKEEHFLMIVSALRNELNQAFVILRSIALGRDLKKFLMVVFGLWIISVVGNWFNFLTLVYICFVVLHTVPMLYEKHEDKVD 218          
BLAST of FC931773 vs. ExPASy Swiss-Prot
Match: RTNLC_ARATH (Reticulon-like protein B3 OS=Arabidopsis thaliana GN=RTNLB3 PE=1 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 1.857e-62
Identity = 125/217 (57.60%), Postives = 150/217 (69.12%), Query Frame = 1
Query:  106 MAEREENPAEPPMEKVSEKIXXXXXXXXXXXXXXNEEPAAQSSVKADIYRLFGRERPVHQVFGGGKPADVFLWRNKKISAGVLGGATAIWVLFELFEYHLLTLVCHTXXXXXXXXXXWANAHTFIKKAPPCIPEVHLPEEPFLQVASAFRIELNHAFAVLRSIASGRDLKSFLMAIAALWVLSVVGSWCNFLTLFYIALVLLHILPGLYEKYEGQID 756
            MAE E    E  MEK+SEKI              +++ +A  S+K  IYRLFGRE+P+H++FGGGKPAD+FLWRNKK+S GVLG AT  W+LFEL EY+LLTL  H           W++A TFI K+P  IPEVH+PE+  LQ+AS  RIE+N  F VLR IASGRDLK FL+ IA LWVLS VGS CNFLTL YIA VLL  +P LYEKYE ++D
Sbjct:    1 MAE-EHKHEESIMEKISEKIHGHDDSSSSSSDSDDDKNSA--SLKTKIYRLFGREQPLHKLFGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILALAVLFLWSSASTFIHKSPLHIPEVHIPEDVVLQLASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGLWVLSKVGSSCNFLTLIYIATVLLFTIPVLYEKYEDKVD 214          
BLAST of FC931773 vs. ExPASy Swiss-Prot
Match: RTNLB_ARATH (Reticulon-like protein B2 OS=Arabidopsis thaliana GN=RTNLB2 PE=1 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 4.138e-62
Identity = 119/212 (56.13%), Postives = 145/212 (68.40%), Query Frame = 1
Query:  133 EPPMEKVSEKIXXXXXXXXXXXXXXNEEPAAQSS----VKADIYRLFGRERPVHQVFGGGKPADVFLWRNKKISAGVLGGATAIWVLFELFEYHLLTLVCHTXXXXXXXXXXWANAHTFIKKAPPCIPEVHLPEEPFLQVASAFRIELNHAFAVLRSIASGRDLKSFLMAIAALWVLSVVGSWCNFLTLFYIALVLLHILPGLYEKYEGQID 756
            E  MEK+SEKI                E  + SS    +K+ +YRLFGRERPVH+V GGGKPAD+F+W++KK+S GV GGAT  WVLFEL EYHLLTL+CH           W+NA  FI K+PP IPEVH+PEEP LQ+AS  RIE+N   + LR IASGRD+K FL AIA LWVLS++G   +FLTL YIALVLL  +P  Y+KYE ++D
Sbjct:   24 ESLMEKLSEKIHHKGDSSSSSSSDDENEKKSSSSSPKSLKSKVYRLFGRERPVHKVLGGGKPADIFMWKDKKMSGGVFGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATMFIHKSPPKIPEVHIPEEPLLQLASGLRIEINRGISSLREIASGRDIKKFLSAIAGLWVLSILGGCYSFLTLAYIALVLLFTVPLFYDKYEDKVD 235          
BLAST of FC931773 vs. ExPASy Swiss-Prot
Match: RTNLD_ARATH (Reticulon-like protein B4 OS=Arabidopsis thaliana GN=RTNLB4 PE=1 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 5.404e-62
Identity = 116/210 (55.24%), Postives = 146/210 (69.52%), Query Frame = 1
Query:  133 EPPMEKVSEKIXXXXXXXXXXXXXXNEEP--AAQSSVKADIYRLFGRERPVHQVFGGGKPADVFLWRNKKISAGVLGGATAIWVLFELFEYHLLTLVCHTXXXXXXXXXXWANAHTFIKKAPPCIPEVHLPEEPFLQVASAFRIELNHAFAVLRSIASGRDLKSFLMAIAALWVLSVVGSWCNFLTLFYIALVLLHILPGLYEKYEGQID 756
            E  +EK+ EKI              +++   ++ SS K+ IYRLFGRE+PVH+V GGGKPAD+FLWRNKK+S GVLG  TA WVLFELFEYHLL  +CH           W+NA TFI K+ P IPEVH+PE+P LQ+ S  RIE+N    +LR+IASG+D+K F++ IA LWVLS++GS  NFLTLFY A VLL  +P LYEKYE ++D
Sbjct:    9 ESILEKIVEKIHGHGDSSSLSDSDDDKKSTSSSSSSFKSKIYRLFGREKPVHKVLGGGKPADIFLWRNKKVSGGVLGAVTASWVLFELFEYHLLAFLCHFAIFALAALFLWSNACTFIHKSTPHIPEVHIPEDPILQLVSGLRIEINRGLTLLRNIASGKDVKKFILVIAGLWVLSIIGSCYNFLTLFYTATVLLFTIPVLYEKYEDKVD 218          
BLAST of FC931773 vs. ExPASy Swiss-Prot
Match: RTNLG_ARATH (Reticulon-like protein B7 OS=Arabidopsis thaliana GN=RTNLB7 PE=2 SV=2)

HSP 1 Score: 191.815 bits (486), Expect = 3.401e-48
Identity = 91/183 (49.73%), Postives = 125/183 (68.31%), Query Frame = 1
Query:  208 NEEPAAQSSVKADIYRLFGRERPVHQVFGGGKPADVFLWRNKKISAGVLGGATAIWVLFELFEYHLLTLVCHTXXXXXXXXXXWANAHTFIKKAPPCIPEVHLPEEPFLQVASAFRIELNHAFAVLRSIASGRDLKSFLMAIAALWVLSVVGSWCNFLTLFYIALVLLHILPGLYEKYEGQID 756
            +E+P +   + A IYR+FGRERP+H V GGGKPADV LWR+KK++ G+L   T IW+LF      LLT +C            W+NA   + K+P  + ++++PE+P LQ ASA   ELN AFA LRSIA  RD+K+F+MA+  LW++SV+G+W +FL+L YI  VL+H +P LYEKYE +ID
Sbjct:   38 SEKPDSPVPINAPIYRMFGRERPIHMVLGGGKPADVLLWRDKKVTLGLLSAVTVIWLLFGFGGRRLLTSLCRGSILFLLLSFLWSNA---LNKSPENMMDIYIPEKPLLQAASAMTFELNCAFATLRSIALERDIKNFVMAVIGLWLVSVIGNWFSFLSLLYICFVLIHTVPMLYEKYEDEID 217          
BLAST of FC931773 vs. ExPASy Swiss-Prot
Match: RTNLH_ARATH (Reticulon-like protein B8 OS=Arabidopsis thaliana GN=RTNLB8 PE=1 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 7.338e-43
Identity = 84/177 (47.46%), Postives = 113/177 (63.84%), Query Frame = 1
Query:  226 QSSVKADIYRLFGRERPVHQVFGGGKPADVFLWRNKKISAGVLGGATAIWVLFELFEYHLLTLVCHTXXXXXXXXXXWANAHTFIKKAPPCIPEVHLPEEPFLQVASAFRIELNHAFAVLRSIASGRDLKSFLMAIAALWVLSVVGSWCNFLTLFYIALVLLHILPGLYEKYEGQID 756
            + SV +   RLF R++P+H V GGGK ADV LWRNKKISA VL GATAIWVLFE   +H L+LVC+           W+NA  F+ ++   +P + LP++ F +V  A   E+N     L+ +A   +LK FLMA+  LWV ++VGS CNFLT+ YI  V  H +P LYE+YE ++D
Sbjct:   35 EDSVSSRFNRLFDRQKPIHHVLGGGKSADVLLWRNKKISASVLMGATAIWVLFEWINFHFLSLVCYALLLGMIAQFVWSNASGFLNRSQSRVPRLVLPKDFFAEVGVAVGKEVNRGLLFLQDLACKGNLKQFLMAVIGLWVAAMVGSCCNFLTVLYIGFVGAHTMPVLYERYEDEVD 211          
BLAST of FC931773 vs. ExPASy Swiss-Prot
Match: RTNLI_ARATH (Reticulon-like protein B9 OS=Arabidopsis thaliana GN=RTNLB9 PE=2 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 2.366e-33
Identity = 64/168 (38.10%), Postives = 98/168 (58.33%), Query Frame = 1
Query:  253 RLFGRERPVHQVFGGGKPADVFLWRNKKISAGVLGGATAIWVLFELFEYHLLTLVCHTXXXXXXXXXXWANAHTFIKKAPPCIPEVHLPEEPFLQVASAFRIELNHAFAVLRSIASGRDLKSFLMAIAALWVLSVVGSWCNFLTLFYIALVLLHILPGLYEKYEGQID 756
            +LF R+R +H +FGGGK AD+ LWR  KI+A ++ G + +W L E+ EY+ +TL+CH           W+ A  F+    P IPEV L E  F Q+A +F +  N     L  +A GRD   F +   +L+++S++G++ NF+ L +I  V +  LP +YE YE  +D
Sbjct:   22 KLFTRQRSIHSIFGGGKVADILLWREPKIAATLVIGVSILWFLMEVVEYNFITLICHASMTSMLFFFIWSTASDFLNWERPLIPEVVLDESSFKQLARSFHVRFNQILTKLLDVACGRDPPLFFLTTISLYIVSIIGTYFNFVNLLFIGFVSMQTLPVMYEMYEDDVD 189          
BLAST of FC931773 vs. ExPASy Swiss-Prot
Match: RTNLP_ARATH (Reticulon-like protein B16 OS=Arabidopsis thaliana GN=RTNLB16 PE=2 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 2.145e-26
Identity = 59/169 (34.91%), Postives = 88/169 (52.07%), Query Frame = 1
Query:  250 YRLFGRERPVHQVFGGGKPADVFLWRNKKISAGVLGGATAIWVLFELFEYHLLTLVCHTXXXXXXXXXXWANAHTFIKKAPPCIPEVHLPEEPFLQVASAFRIELNHAFAVLRSIASGRDLKSFLMAIAALWVLSVVGSWCNFLTLFYIALVLLHILPGLYEKYEGQID 756
            YRL GR+  VHQ  GGGK AD+ LWR + +S GV+  +T  W++FE      L++               A    F  +    +PE+ L EE     A++FRI+LNH   +   +  G D + F   +  LW+LS +GS+ +  TL YI  +L   +P LY KY+ ++D
Sbjct:   23 YRLLGRQITVHQFMGGGKAADLLLWRRRHLSLGVIIISTVAWLIFEFSGLPFLSVSSDVLLIVIMISFVHARVSAFRNRQLHSLPELVLSEEMVNSAAASFRIKLNHLLVMAHDVTVGNDFRLFFKVVICLWLLSAIGSYISLCTLLYIGTILSVTIPALYSKYQSKVD 191          
The following BLAST results are available for this feature:
BLAST of FC931773 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
RTNLE_ARATH3.616e-6658.14Reticulon-like protein B5 OS=Arabidopsis thaliana ... [more]
RTNLA_ARATH2.592e-6456.48Reticulon-like protein B1 OS=Arabidopsis thaliana ... [more]
RTNLF_ARATH1.680e-6355.81Reticulon-like protein B6 OS=Arabidopsis thaliana ... [more]
RTNLC_ARATH1.857e-6257.60Reticulon-like protein B3 OS=Arabidopsis thaliana ... [more]
RTNLB_ARATH4.138e-6256.13Reticulon-like protein B2 OS=Arabidopsis thaliana ... [more]
RTNLD_ARATH5.404e-6255.24Reticulon-like protein B4 OS=Arabidopsis thaliana ... [more]
RTNLG_ARATH3.401e-4849.73Reticulon-like protein B7 OS=Arabidopsis thaliana ... [more]
RTNLH_ARATH7.338e-4347.46Reticulon-like protein B8 OS=Arabidopsis thaliana ... [more]
RTNLI_ARATH2.366e-3338.10Reticulon-like protein B9 OS=Arabidopsis thaliana ... [more]
RTNLP_ARATH2.145e-2634.91Reticulon-like protein B16 OS=Arabidopsis thaliana... [more]

Pages

back to top
Libraries
Library NameType
PostHarveNcdna_library
Properties
Property NameValue
Genbank descriptionC34201A09EF PostHarveN Citrus clementina cDNA clone C34201A09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931773 ID=FC931773|Name=FC931773|organism=Citrus clementina|type=EST|length=758bp
AGAAATTACACCGGACAGAAACATCAGCTTTCTTTTCCCTTTCATTGTCC
CTCGCACCGAAATTTCGCCAAAAAAAAAAAATTCAATTAGGTTTTCCGAG
AAAAGATGGCGGAGCGTGAAGAGAATCCGGCGGAACCGCCAATGGAGAAG
GTAAGCGAGAAGATTCACGATCACGATTCCTCGTCATCGTCGTCTTCGGA
TTCTGATAATGAGGAACCGGCTGCCCAGTCGTCTGTGAAGGCGGATATTT
ATCGTTTATTTGGCAGAGAGCGGCCGGTTCACCAGGTTTTCGGTGGTGGA
AAGCCTGCTGATGTTTTTTTGTGGAGGAACAAGAAGATTTCAGCGGGTGT
ACTAGGTGGAGCCACGGCTATCTGGGTCCTTTTCGAGTTGTTTGAATACC
ACCTGCTTACTTTGGTCTGCCACACCTTAATTCTTGCACTTGCAATCTTG
TTCCTGTGGGCCAATGCCCATACCTTCATTAAGAAGGCCCCACCCTGCAT
CCCTGAAGTTCATCTTCCTGAGGAGCCATTCCTGCAGGTTGCTTCTGCCT
TTAGGATTGAACTCAACCATGCTTTTGCAGTATTGCGGAGTATTGCATCA
GGAAGAGATTTGAAGAGTTTTCTCATGGCTATAGCTGCCTTGTGGGTGCT
GTCAGTTGTGGGGAGTTGGTGCAACTTCTTGACCTTGTTTTATATAGCTT
TGGTTTTGCTGCACATTTTGCCTGGTCTCTATGAGAAGTATGAGGGACAG
ATTGATCC
back to top