FC931775

Overview
NameFC931775
Unique NameFC931775
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length693
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC931775_ssr15 microsatellite FC931775_ssr15:15..28. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig10254 contig Ccv1_Contig10254:1..691. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931775 vs. ExPASy Swiss-Prot
Match: SAHH_CATRO (Adenosylhomocysteinase OS=Catharanthus roseus GN=SAHH PE=2 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 1.678e-88
Identity = 157/187 (83.96%), Postives = 168/187 (89.84%), Query Frame = 2
Query:  131 MALSVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWEGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKA 691
            MAL VEK++SGRE+KVKD+SQADFGRLEIELAEVEMPGLM+CRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQ+H              W+GETLQEYWWCTE+ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y+K G LPDP+STDNAEFQIVLTIIRDGLK+
Sbjct:    1 MALLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQEHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYKKNGALPDPSSTDNAEFQIVLTIIRDGLKS 187          
BLAST of FC931775 vs. ExPASy Swiss-Prot
Match: SAHH_MEDSA (Adenosylhomocysteinase OS=Medicago sativa GN=SAHH PE=2 SV=1)

HSP 1 Score: 323.553 bits (828), Expect = 6.376e-88
Identity = 154/186 (82.80%), Postives = 166/186 (89.25%), Query Frame = 2
Query:  131 MALSVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWEGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLK 688
            MAL VE + SGRE+KVKD+SQADFGRLEIELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              W+GETLQEYWWC+E+ALDWGPGGGPDLIVDDGGD TLLIHEGVKAEE++EKTG+LPDP+STDNAE QIVLTIIRDGLK
Sbjct:    1 MALLVETTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCSERALDWGPGGGPDLIVDDGGDVTLLIHEGVKAEEVFEKTGQLPDPSSTDNAEMQIVLTIIRDGLK 186          
BLAST of FC931775 vs. ExPASy Swiss-Prot
Match: SAHH1_ARATH (Adenosylhomocysteinase 1 OS=Arabidopsis thaliana GN=SAHH1 PE=1 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 8.327e-88
Identity = 153/186 (82.26%), Postives = 168/186 (90.32%), Query Frame = 2
Query:  131 MALSVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWEGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLK 688
            MAL VEK++SGRE+KVKD+SQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              W+GETLQEYWWCTE+ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEI+EKTG++PDP STDN EFQIVL+II++GL+
Sbjct:    1 MALLVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEGLQ 186          
BLAST of FC931775 vs. ExPASy Swiss-Prot
Match: SAHH_PETCR (Adenosylhomocysteinase OS=Petroselinum crispum GN=SAHH PE=2 SV=2)

HSP 1 Score: 320.857 bits (821), Expect = 4.133e-87
Identity = 153/187 (81.82%), Postives = 167/187 (89.30%), Query Frame = 2
Query:  131 MALSVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWEGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKA 691
            MALSVEK+A+GRE+KVKD+S ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMTIQT VLIETLTALGAEVRWCSCNIFSTQDH              W+GETLQEYWWCTE+ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y+K+G +PDPASTDNAEFQIVL+IIRDGLK+
Sbjct:    1 MALSVEKTAAGREYKVKDMSLADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMTIQTGVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSCAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYKKSGAIPDPASTDNAEFQIVLSIIRDGLKS 187          
BLAST of FC931775 vs. ExPASy Swiss-Prot
Match: SAHH_LUPLU (Adenosylhomocysteinase OS=Lupinus luteus GN=SAHH PE=2 SV=1)

HSP 1 Score: 320.472 bits (820), Expect = 5.397e-87
Identity = 154/186 (82.80%), Postives = 166/186 (89.25%), Query Frame = 2
Query:  131 MALSVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWEGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLK 688
            MAL VEK+ SGRE+KVKD+SQADFGRLEIELAEVEMPGLMA R+EFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              W+GETLQEYWWCTE+ALDWGPGGGPDLIVDDGGD TLLIHEGVKAEEIYEK+G+ PDP STDNAEF+IVL+II++GLK
Sbjct:    1 MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRSEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDTTLLIHEGVKAEEIYEKSGQFPDPDSTDNAEFKIVLSIIKEGLK 186          
BLAST of FC931775 vs. ExPASy Swiss-Prot
Match: SAHH_MESCR (Adenosylhomocysteinase OS=Mesembryanthemum crystallinum GN=SAHH PE=2 SV=1)

HSP 1 Score: 318.931 bits (816), Expect = 1.570e-86
Identity = 153/186 (82.26%), Postives = 163/186 (87.63%), Query Frame = 2
Query:  131 MALSVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWEGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLK 688
            MAL+VEK++SGRE+KVKD+SQADFGRLEIELAEVEMPGLMACR EFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              W+GETLQEYWWCTE+ALDWG GGGPDLIVDDGGDATLLIHEGVKAEE YEK G +PDP STDN EFQ+VL +IRD LK
Sbjct:    1 MALAVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGAGGGPDLIVDDGGDATLLIHEGVKAEEEYEKNGTIPDPTSTDNPEFQLVLGLIRDSLK 186          
BLAST of FC931775 vs. ExPASy Swiss-Prot
Match: SAHH_TOBAC (Adenosylhomocysteinase OS=Nicotiana tabacum GN=SAHH PE=2 SV=1)

HSP 1 Score: 318.546 bits (815), Expect = 2.051e-86
Identity = 153/186 (82.26%), Postives = 163/186 (87.63%), Query Frame = 2
Query:  131 MALSVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWEGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLK 688
            MAL VEK+ SGRE+KVKD+SQADFGRLEIELAEVEMPGLMACR EFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              W+GETLQEYWWCTE+ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G +PDP STDNAEFQ+VLTII++ LK
Sbjct:    1 MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTIPDPNSTDNAEFQLVLTIIKESLK 186          
BLAST of FC931775 vs. ExPASy Swiss-Prot
Match: SAHH_PHASS (Adenosylhomocysteinase OS=Phalaenopsis sp. GN=SAHH PE=2 SV=1)

HSP 1 Score: 318.546 bits (815), Expect = 2.051e-86
Identity = 154/185 (83.24%), Postives = 163/185 (88.11%), Query Frame = 2
Query:  131 MALSVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWEGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGL 685
            MAL VEK+ SGRE+KVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGA+I+GSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              W+GETLQEYWWCTE+ L+WG GGGPDLIVDDGGDATLLIHEGVKAEE YEK GK+PDPASTDNAEFQIVL +IRD L
Sbjct:    1 MALLVEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERCLEWGAGGGPDLIVDDGGDATLLIHEGVKAEEEYEKNGKIPDPASTDNAEFQIVLGLIRDSL 185          
BLAST of FC931775 vs. ExPASy Swiss-Prot
Match: SAHH_NICSY (Adenosylhomocysteinase OS=Nicotiana sylvestris GN=SAHH PE=2 SV=1)

HSP 1 Score: 318.546 bits (815), Expect = 2.051e-86
Identity = 153/186 (82.26%), Postives = 163/186 (87.63%), Query Frame = 2
Query:  131 MALSVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWEGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLK 688
            MAL VEK+ SGRE+KVKD+SQADFGRLEIELAEVEMPGLMACR EFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              W+GETLQEYWWCTE+ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G +PDP STDNAEFQ+VLTII++ LK
Sbjct:    1 MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTIPDPNSTDNAEFQLVLTIIKESLK 186          
BLAST of FC931775 vs. ExPASy Swiss-Prot
Match: SAHH_WHEAT (Adenosylhomocysteinase OS=Triticum aestivum GN=SAHH PE=2 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 1.329e-85
Identity = 151/186 (81.18%), Postives = 165/186 (88.71%), Query Frame = 2
Query:  131 MALSVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWEGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLK 688
            MALSVEK++SGRE+KVKDL QADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+I+GSLHMTIQTAVLIETLTALGAEVRWCSCNIFS+QDH              W+GETL+EYWWCTE+ LDWG GGGPDLIVDDGGDATLLIHEGVKAEE +EK+GK+PDP STDN EF+IVLTIIRDGLK
Sbjct:    1 MALSVEKTSSGREYKVKDLFQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARISGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSSQDHAAAAIARDSAAVFAWKGETLEEYWWCTERCLDWGVGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKVPDPESTDNPEFKIVLTIIRDGLK 186          
The following BLAST results are available for this feature:
BLAST of FC931775 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
SAHH_CATRO1.678e-8883.96Adenosylhomocysteinase OS=Catharanthus roseus GN=S... [more]
SAHH_MEDSA6.376e-8882.80Adenosylhomocysteinase OS=Medicago sativa GN=SAHH ... [more]
SAHH1_ARATH8.327e-8882.26Adenosylhomocysteinase 1 OS=Arabidopsis thaliana G... [more]
SAHH_PETCR4.133e-8781.82Adenosylhomocysteinase OS=Petroselinum crispum GN=... [more]
SAHH_LUPLU5.397e-8782.80Adenosylhomocysteinase OS=Lupinus luteus GN=SAHH P... [more]
SAHH_MESCR1.570e-8682.26Adenosylhomocysteinase OS=Mesembryanthemum crystal... [more]
SAHH_TOBAC2.051e-8682.26Adenosylhomocysteinase OS=Nicotiana tabacum GN=SAH... [more]
SAHH_PHASS2.051e-8683.24Adenosylhomocysteinase OS=Phalaenopsis sp. GN=SAHH... [more]
SAHH_NICSY2.051e-8682.26Adenosylhomocysteinase OS=Nicotiana sylvestris GN=... [more]
SAHH_WHEAT1.329e-8581.18Adenosylhomocysteinase OS=Triticum aestivum GN=SAH... [more]

Pages

back to top
Libraries
Library NameType
PostHarveNcdna_library
Properties
Property NameValue
Genbank descriptionC34201A11EF PostHarveN Citrus clementina cDNA clone C34201A11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931775 ID=FC931775|Name=FC931775|organism=Citrus clementina|type=EST|length=693bp
GTCGCTCACACCCACTCTCTCTCTCTCTCGCTTGTACAATCATTCACTTT
GTTTGGTTAGTTTCCAAAGAGAGAGTAGATTGCCCTCTCTTCCTTCTTTC
TTGTAGATCTATCAATTCTATTAATCAACCATGGCTTTGTCCGTCGAGAA
ATCCGCTAGCGGTCGTGAATTCAAGGTGAAGGATCTGTCCCAGGCTGACT
TCGGCCGCCTCGAAATCGAGTTGGCCGAAGTCGAAATGCCGGGGCTCATG
GCTTGCCGCGCCGAGTTCGGCCCTTCACAGCCTTTCAAAGGAGCCAAGAT
CACCGGTTCACTCCACATGACCATCCAGACGGCCGTCCTCATCGAGACGC
TCACCGCTCTCGGCGCCGAAGTCCGCTGGTGCTCCTGCAACATCTTCTCA
ACCCAAGACCACGCGGCCGCCGCCATCGCACGTGACTCCGCCTCCGTCTT
TGCCTGGGAGGGTGAGACCCTCCAGGAGTACTGGTGGTGCACGGAGAAAG
CCCTGGACTGGGGTCCCGGCGGCGGCCCAGATCTCATCGTCGATGACGGT
GGTGACGCCACGTTGTTGATCCACGAGGGAGTCAAAGCTGAGGAGATCTA
CGAGAAGACCGGGAAGTTGCCCGACCCGGCCTCCACCGACAACGCCGAGT
TTCAGATTGTTTTGACTATCATTAGAGATGGGTTGAAGGCCGA
back to top