FC931777

Overview
NameFC931777
Unique NameFC931777
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length705
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig11663 contig Ccv1_Contig11663:167..872. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931777 vs. ExPASy Swiss-Prot
Match: HMGCL_ARATH (Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Arabidopsis thaliana GN=HMGCL PE=1 SV=2)

HSP 1 Score: 268.47 bits (685), Expect = 2.538e-71
Identity = 142/229 (62.01%), Postives = 167/229 (72.93%), Query Frame = 1
Query:   31 LRNPNFDFSVSFTIMSSLEEPLGLDKLPSMSTIDRIQRFSSNACRPSGDGMGMGSCWIEGSSCSTSNSYDEDYDEYTREAFPWRRHTRDMSHGDSFSRRTVSLGRNHKMFGSACDI-------YNSNCNDKDIRDITNKFLKGTPRFVKIVEVGPRDGLQNEKNTVPTGVKVELIRRLVSSGLPVVEATSFVSPKWVPQLADARDVMEAVRDLEGARLPVLTPNLRGLK 696
            L +P+   S  FT MSSLEEPL  DKLPSMST+DRIQRFSS ACRP  D +GMG  WIEG  C+TSNS  +D   + +E+FPWRRHTR +S G+   R     GR   + G+  +        Y++  N+     I+NK  KG P+FVKIVEVGPRDGLQNEKN VPT VKVELI+RLVSSGLPVVEATSFVSPKWVPQLADA+DVM+AV  L+GARLPVLTPNL+G +
Sbjct:   23 LHHPSIPVSHFFT-MSSLEEPLSFDKLPSMSTMDRIQRFSSGACRPRDD-VGMGHRWIEGRDCTTSNSCIDDDKSFAKESFPWRRHTRKLSEGEHMFRNISFAGRTSTVSGTLRESKSFKEQKYSTFSNENGTSHISNKISKGIPKFVKIVEVGPRDGLQNEKNIVPTSVKVELIQRLVSSGLPVVEATSFVSPKWVPQLADAKDVMDAVNTLDGARLPVLTPNLKGFQ 249          
BLAST of FC931777 vs. ExPASy Swiss-Prot
Match: HMGCL_BOVIN (Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Bos taurus GN=HMGCL PE=2 SV=2)

HSP 1 Score: 117.087 bits (292), Expect = 9.450e-26
Identity = 56/97 (57.73%), Postives = 72/97 (74.23%), Query Frame = 1
Query:  406 IRDITNKFLKGTPRFVKIVEVGPRDGLQNEKNTVPTGVKVELIRRLVSSGLPVVEATSFVSPKWVPQLADARDVMEAVRDLEGARLPVLTPNLRGLK 696
            +R ++   +   P+ VKIVEVGPRDGLQNEKN VPT VK++LI  L  +GLPVVEATSFVSPKWVPQ+AD  +V++ ++   G   PVLTPN +G +
Sbjct:   18 LRAVSTSSVGTFPKQVKIVEVGPRDGLQNEKNIVPTPVKIKLIDMLSEAGLPVVEATSFVSPKWVPQMADHAEVLKGIQKFPGVNYPVLTPNFKGFQ 114          
BLAST of FC931777 vs. ExPASy Swiss-Prot
Match: HMGC2_MOUSE (Probable 3-hydroxymethyl-3-methylglutaryl-CoA lyase 2 OS=Mus musculus GN=Hmgcll1 PE=2 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.234e-25
Identity = 55/89 (61.80%), Postives = 67/89 (75.28%), Query Frame = 1
Query:  430 LKGTPRFVKIVEVGPRDGLQNEKNTVPTGVKVELIRRLVSSGLPVVEATSFVSPKWVPQLADARDVMEAVRDLEGARLPVLTPNLRGLK 696
            L G P +VKIVEVGPRDGLQNEK  VPT +K+ELI +L  +GL V+E TSFVS +WVPQ+AD  +VM  +R   G R PVLTPNL+G +
Sbjct:   41 LPGLPEYVKIVEVGPRDGLQNEKVIVPTDIKIELINQLSQTGLSVIEVTSFVSSRWVPQMADHAEVMRGIRQYPGVRYPVLTPNLQGFQ 129          
BLAST of FC931777 vs. ExPASy Swiss-Prot
Match: HMGC2_HUMAN (Probable 3-hydroxymethyl-3-methylglutaryl-CoA lyase 2 OS=Homo sapiens GN=HMGCLL1 PE=2 SV=3)

HSP 1 Score: 116.316 bits (290), Expect = 1.612e-25
Identity = 55/87 (63.22%), Postives = 65/87 (74.71%), Query Frame = 1
Query:  430 LKGTPRFVKIVEVGPRDGLQNEKNTVPTGVKVELIRRLVSSGLPVVEATSFVSPKWVPQLADARDVMEAVRDLEGARLPVLTPNLRG 690
            L G P FVKIVEVGPRDGLQNEK  VPT +K+E I RL  +GL V+E TSFVS +WVPQ+AD  +VM+ +    G R PVLTPNL+G
Sbjct:   71 LSGLPEFVKIVEVGPRDGLQNEKVIVPTDIKIEFINRLSQTGLSVIEVTSFVSSRWVPQMADHTEVMKGIHQYPGVRYPVLTPNLQG 157          
BLAST of FC931777 vs. ExPASy Swiss-Prot
Match: HMGCL_RAT (Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Rattus norvegicus GN=Hmgcl PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 2.105e-25
Identity = 54/85 (63.53%), Postives = 68/85 (80.00%), Query Frame = 1
Query:  442 PRFVKIVEVGPRDGLQNEKNTVPTGVKVELIRRLVSSGLPVVEATSFVSPKWVPQLADARDVMEAVRDLEGARLPVLTPNLRGLK 696
            P+ VKIVEVGPRDGLQNEK+ VPT VK++LI  L  +GLPV+EATSFVSPKWVPQ+AD  DV++ ++   G   PVLTPN++G +
Sbjct:   30 PKRVKIVEVGPRDGLQNEKSIVPTPVKIKLIDMLSEAGLPVIEATSFVSPKWVPQMADHSDVLKGIQKFPGINYPVLTPNMKGFE 114          
BLAST of FC931777 vs. ExPASy Swiss-Prot
Match: HMGCL_CHICK (Hydroxymethylglutaryl-CoA lyase OS=Gallus gallus GN=HMGCL PE=1 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 2.105e-25
Identity = 54/85 (63.53%), Postives = 67/85 (78.82%), Query Frame = 1
Query:  442 PRFVKIVEVGPRDGLQNEKNTVPTGVKVELIRRLVSSGLPVVEATSFVSPKWVPQLADARDVMEAVRDLEGARLPVLTPNLRGLK 696
            P+ VK+VEVGPRDGLQNEK+ VPT VK+ LI  L  +GLPV+EATSFVSP+WVPQ+AD  +VM+ +  L G   PVLTPNL+G +
Sbjct:    3 PQRVKVVEVGPRDGLQNEKSVVPTPVKIRLIDMLSETGLPVIEATSFVSPRWVPQMADHAEVMQGINKLPGVSYPVLTPNLKGFQ 87          
BLAST of FC931777 vs. ExPASy Swiss-Prot
Match: HMGCL_MOUSE (Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Mus musculus GN=Hmgcl PE=1 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 3.591e-25
Identity = 54/97 (55.67%), Postives = 71/97 (73.20%), Query Frame = 1
Query:  406 IRDITNKFLKGTPRFVKIVEVGPRDGLQNEKNTVPTGVKVELIRRLVSSGLPVVEATSFVSPKWVPQLADARDVMEAVRDLEGARLPVLTPNLRGLK 696
            +R ++   +   P+ VKIVEVGPRDGLQNEK+ VPT VK+ LI  L  +GLPV+EATSFVSP WVPQ+AD  DV++ ++   G   PVLTPN++G +
Sbjct:   18 LRAVSTSSMGTLPKQVKIVEVGPRDGLQNEKSIVPTPVKIRLIDMLSEAGLPVIEATSFVSPNWVPQMADHSDVLKGIQKFPGINYPVLTPNMKGFE 114          
BLAST of FC931777 vs. ExPASy Swiss-Prot
Match: HMGCL_MACFA (Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Macaca fascicularis GN=HMGCL PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 1.155e-23
Identity = 53/97 (54.64%), Postives = 70/97 (72.16%), Query Frame = 1
Query:  406 IRDITNKFLKGTPRFVKIVEVGPRDGLQNEKNTVPTGVKVELIRRLVSSGLPVVEATSFVSPKWVPQLADARDVMEAVRDLEGARLPVLTPNLRGLK 696
            +R ++   +   P+ VKIVEVGPRDGLQNEKN V T VK++LI  L  +GL V+EATSFVSPKWVPQ+AD  +V++ ++   G   PVL PNL+G +
Sbjct:   18 LRAVSTSSMDTLPKQVKIVEVGPRDGLQNEKNIVSTPVKIKLIDMLSEAGLSVIEATSFVSPKWVPQMADHAEVLKGIQKFPGITYPVLIPNLKGFE 114          
BLAST of FC931777 vs. ExPASy Swiss-Prot
Match: HMGCL_PONAB (Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Pongo abelii GN=HMGCL PE=2 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.971e-23
Identity = 52/97 (53.61%), Postives = 69/97 (71.13%), Query Frame = 1
Query:  406 IRDITNKFLKGTPRFVKIVEVGPRDGLQNEKNTVPTGVKVELIRRLVSSGLPVVEATSFVSPKWVPQLADARDVMEAVRDLEGARLPVLTPNLRGLK 696
            +R ++   +   P+ VKIVEVGPRDGLQNEKN V T VK++LI  L  +GL V+E TSFVSPKWVPQ+ D  +V++ ++   G   PVLTPNL+G +
Sbjct:   18 LRAVSTSSMGTLPKRVKIVEVGPRDGLQNEKNIVSTPVKIKLIDMLSEAGLSVIETTSFVSPKWVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFE 114          
BLAST of FC931777 vs. ExPASy Swiss-Prot
Match: HMGCL_HUMAN (Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Homo sapiens GN=HMGCL PE=1 SV=2)

HSP 1 Score: 109.383 bits (272), Expect = 1.971e-23
Identity = 52/97 (53.61%), Postives = 69/97 (71.13%), Query Frame = 1
Query:  406 IRDITNKFLKGTPRFVKIVEVGPRDGLQNEKNTVPTGVKVELIRRLVSSGLPVVEATSFVSPKWVPQLADARDVMEAVRDLEGARLPVLTPNLRGLK 696
            +R ++   +   P+ VKIVEVGPRDGLQNEKN V T VK++LI  L  +GL V+E TSFVSPKWVPQ+ D  +V++ ++   G   PVLTPNL+G +
Sbjct:   18 LRAVSTSSMGTLPKRVKIVEVGPRDGLQNEKNIVSTPVKIKLIDMLSEAGLSVIETTSFVSPKWVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFE 114          
The following BLAST results are available for this feature:
BLAST of FC931777 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
HMGCL_ARATH2.538e-7162.01Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=... [more]
HMGCL_BOVIN9.450e-2657.73Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=... [more]
HMGC2_MOUSE1.234e-2561.80Probable 3-hydroxymethyl-3-methylglutaryl-CoA lyas... [more]
HMGC2_HUMAN1.612e-2563.22Probable 3-hydroxymethyl-3-methylglutaryl-CoA lyas... [more]
HMGCL_RAT2.105e-2563.53Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=... [more]
HMGCL_CHICK2.105e-2563.53Hydroxymethylglutaryl-CoA lyase OS=Gallus gallus G... [more]
HMGCL_MOUSE3.591e-2555.67Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=... [more]
HMGCL_MACFA1.155e-2354.64Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=... [more]
HMGCL_PONAB1.971e-2353.61Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=... [more]
HMGCL_HUMAN1.971e-2353.61Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=... [more]

Pages

back to top
Libraries
Library NameType
PostHarveNcdna_library
Properties
Property NameValue
Genbank descriptionC34201B01EF PostHarveN Citrus clementina cDNA clone C34201B01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931777 ID=FC931777|Name=FC931777|organism=Citrus clementina|type=EST|length=705bp
GAAATTCTAAAGTTTCTTCCTTTTTCTATTCTCAGAAACCCTAATTTTGA
CTTCAGTGTATCTTTCACCATCATGTCAAGCTTGGAGGAGCCACTTGGTC
TTGACAAGCTGCCAAGCATGAGCACCATTGATAGGATTCAGAGGTTCTCC
TCCAATGCTTGCAGACCTAGTGGGGATGGTATGGGAATGGGGAGCTGCTG
GATTGAGGGGAGCAGTTGCAGCACCTCCAACAGTTATGATGAAGATTATG
ATGAATATACAAGAGAGGCATTCCCATGGAGAAGACATACAAGGGACATG
TCTCATGGTGACTCCTTCAGTCGTAGAACTGTAAGCTTAGGAAGAAATCA
CAAGATGTTTGGAAGTGCTTGTGACATATATAATTCCAATTGCAATGACA
AAGACATACGAGATATAACAAATAAGTTTTTGAAAGGTACACCAAGGTTT
GTGAAGATAGTAGAAGTTGGTCCGAGAGATGGATTGCAAAATGAGAAGAA
TACTGTACCCACGGGTGTAAAGGTGGAACTGATTCGCAGATTAGTGTCCT
CTGGGTTACCTGTTGTTGAGGCTACAAGTTTTGTCTCTCCAAAATGGGTT
CCTCAGCTAGCAGATGCAAGGGATGTAATGGAGGCCGTCCGTGATTTGGA
GGGAGCTAGATTGCCTGTTCTCACACCTAATTTAAGGGGTTTGAAGCTGC
CATTG
back to top